DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxP and jumu

DIOPT Version :9

Sequence 1:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster


Alignment Length:270 Identity:66/270 - (24%)
Similarity:103/270 - (38%) Gaps:72/270 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 SIGRPIRQTNSPSPLNLPMVNSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLDVQQEIHRNREF 321
            |:|.|  .:.|.|..:.|:.|.:||.:|.    :.||.....||...|       ||::      
  Fly   355 SLGSP--SSLSSSSASSPLGNVSNLVNIA----NNNTSGAGSGLVKPL-------QQKV------ 400

  Fly   322 YKNADV-----RPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLS 381
             |...|     :|.::|:.||..|:.:|....|.::|||::....|.||....:.|||::|.|||
  Fly   401 -KLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLS 464

  Fly   382 LHKCFVRYEDDFGSFWMVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQSGNGVPTDKNPCDNCTQH 446
            |:|||.:.|                 |..:.|..||        .|:.... |...|..|...|.
  Fly   465 LNKCFEKIE-----------------RPATNGNQRK--------GCRWAMN-PDRINKMDEEVQK 503

  Fly   447 CTSLPPGADNPLDSNNPNDLGRIGCLPYCGS-DGLSKASKDYSNMDSGM-------IESNSHLTI 503
            .:...|.|..             |.:.|... :.|.:....:.:.||.:       ||.:|.|..
  Fly   504 WSRKDPAAIR-------------GAMVYPQHLESLERGEMKHGSADSDVELDSQSEIEESSDLEE 555

  Fly   504 DEYSTNMYES 513
            .|:...|.::
  Fly   556 HEFEDTMVDA 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777
FH 328..400 CDD:238016 25/71 (35%)
jumuNP_524302.1 Forkhead 411..499 CDD:278670 32/113 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.