DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxP and FoxL1

DIOPT Version :9

Sequence 1:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster


Alignment Length:318 Identity:82/318 - (25%)
Similarity:126/318 - (39%) Gaps:78/318 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 VNS-IGRP--IRQTNSPSPLNLPMVNSTN----LCSIKKRNHDKNTFSINGGLPYMLERAGLDVQ 312
            ||| :..|  :|...||:||....|....    :|.           |.:....|.    |:|..
  Fly    19 VNSMLANPDYLRTQVSPNPLAPSAVGGAGMEGLMCG-----------SFSPAFYYQ----GIDSF 68

  Fly   313 QEIHRN-----REFYKNA--DVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAA 370
            ..:|.|     ..|..|:  ..:|||:|.:||..||..:|:::|||:.||.:..:.|.|:|.|..
  Fly    69 LALHNNIWGLPISFLHNSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQ 133

  Fly   371 TWKNAIRTNLSLHKCFVRYEDD-----------FGSFWMVDDNEF-------VKRRHLSR----G 413
            .|:|:||.||||:.|||:...|           .||:||:|.:..       .:||...|    |
  Fly   134 GWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCG 198

  Fly   414 RPRKYEPSSSPNSCQSGNG----VPTDKNPCDNCTQHCTSLPPGAD----------------NPL 458
            .|.:||..|..:| ..||.    :.:...|..:....|...|..:|                |.|
  Fly   199 HPNRYERESGKDS-NDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLGFNSL 262

  Fly   459 DSNNPNDLGRIGCLPYCGSDGLSKASKDYSNMDSGMIESNSHLTIDEYSTNMYESSAN 516
            .:|....|..:..:..|..|      .|.|:..|..::|:..|..:.:|.:.:....|
  Fly   263 FNNEARGLRPLPEIRECPDD------VDASSSSSKAMQSSMELHEELHSPSAFTPPLN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777
FH 328..400 CDD:238016 34/82 (41%)
FoxL1NP_001246609.1 FH 91..185 CDD:214627 35/93 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.