DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxP and Foxp4

DIOPT Version :9

Sequence 1:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_038939738.1 Gene:Foxp4 / 363185 RGDID:1311386 Length:691 Species:Rattus norvegicus


Alignment Length:371 Identity:159/371 - (42%)
Similarity:201/371 - (54%) Gaps:68/371 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 HPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESHLQKERDRLQA 219
            |||:.||.|:|||||...||:..|:|||||||.||||||||.|||||||.|||..|.||.:||||
  Rat   306 HPLYGHGECKWPGCETLCEDLGQFIKHLNTEHALDDRSTAQCRVQMQVVQQLEIQLAKESERLQA 370

  Fly   220 MMHHLYLS-------KQLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRPIRQTNSP-------SP 270
            ||.||::.       .|...|.......||| ...|  |.:||::...|....:.|       :|
  Rat   371 MMAHLHMRPSEPKPFSQPHLPRCSQLNPVPG-SSSF--SKVTVSADPFPDGLVHPPTSAAAPVTP 432

  Fly   271 LNLPMVNSTNLCS---IKKRNHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYKNADVRPPFT 332
            |..|.:.|.:|..   .::|::||....|:               .|:.:|.|||||||||||||
  Rat   433 LRPPGLGSASLHGGGPARRRSNDKFCSPIS---------------SELAQNHEFYKNADVRPPFT 482

  Fly   333 YASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVRYEDDFGSFW 397
            |||||||||:::||:|||||||||||...|.|||||.||||||:|.||||||||||.|:..|:.|
  Rat   483 YASLIRQAILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVW 547

  Fly   398 MVDDNEFVKRRHLSRGRPRKYEPS-----------------SSPNSCQSGNGVPTDKNPCDNCTQ 445
            .||:.|:.||      ||.|...|                 :|..:..:.:..|...:|      
  Rat   548 TVDEREYQKR------RPPKMTGSPTLVKNMISGLSYGALNASYQAALAESSFPLLSSP------ 600

  Fly   446 HCTSLPPGADNPLDSNNPNDLGRIG-CLPYCGSDGLSKAS-KDYSN 489
              ..|.||:.:.|...:.:|:|..| .||..||....:.| ..||:
  Rat   601 --GMLNPGSASSLLPLSQDDMGAPGEPLPSNGSSSPPRLSPPQYSH 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 46/66 (70%)
FH 328..400 CDD:238016 53/71 (75%)
Foxp4XP_038939738.1 FOXP-CC 308..375 CDD:406546 46/66 (70%)
COG5025 <374..>571 CDD:227358 94/220 (43%)
FH_FOXP4 478..564 CDD:410841 61/91 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5287
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001519
OrthoInspector 1 1.000 - - otm45502
orthoMCL 1 0.900 - - OOG6_103982
Panther 1 1.100 - - O PTHR45796
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X957
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.910

Return to query results.
Submit another query.