DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxP and slp1

DIOPT Version :9

Sequence 1:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster


Alignment Length:172 Identity:57/172 - (33%)
Similarity:93/172 - (54%) Gaps:24/172 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 NSPSPLNLPMVNSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLDVQQEIH-----RNREFYKNA 325
            :|||..:.||.::..  |:..:|:||.....:..|     ...||..||..     :.::....:
  Fly    59 DSPSRTSTPMSSAAE--SLSSQNNDKLDVEFDDEL-----EDQLDEDQESEDGNPSKKQKMTAGS 116

  Fly   326 DV-RPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVR- 388
            |. :||::|.:||..||.|||:::||||.||.:..|.|.||:.|...|:|:||.||||:|||.: 
  Fly   117 DTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKI 181

  Fly   389 ---YED-DFGSFWMVD---DNEFVKRRHLSRGRPRKYEPSSS 423
               |:| ..|::|::|   :..|:..   :.|:.|:..|.:|
  Fly   182 PRSYDDPGKGNYWILDPSAEEVFIGE---TTGKLRRKNPGAS 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777
FH 328..400 CDD:238016 36/76 (47%)
slp1NP_476730.1 FH 120..205 CDD:214627 37/84 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445489
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.