DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxP and fkh-8

DIOPT Version :9

Sequence 1:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001254107.1 Gene:fkh-8 / 174026 WormBaseID:WBGene00001440 Length:328 Species:Caenorhabditis elegans


Alignment Length:183 Identity:52/183 - (28%)
Similarity:82/183 - (44%) Gaps:58/183 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 STNLCSIKKRNHDKNTFSINGGLPYMLERAGLDVQQEIH-------------------------- 316
            |::||.                |.:::.:.||:..|||.                          
 Worm     5 SSSLCQ----------------LNWLIAKGGLNTVQEIEVPENPNIVGSVNVSPLVLSPTVPAET 53

  Fly   317 ----------RNREFYKNADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNA-A 370
                      :.|..:..|| :||::|:.|||.||.|:|||:.||.|||::..:.|.::|.|. :
 Worm    54 SKPVAPAHEGKRRRIFDGAD-KPPYSYSQLIRLAIEDTPDKKCTLAEIYSFIAHNFQFYRENRNS 117

  Fly   371 TWKNAIRTNLSLHKCFVRYEDDFG---SFWMVDDNEFVKRRHLSRGRPRKYEP 420
            :|||:||.||||:|.|.|.|...|   .:|:..|.. .|:..:.:|.|.:..|
 Worm   118 SWKNSIRHNLSLNKQFSRIEKTDGDRRGWWVCVDPP-AKKPRILKGSPVRVNP 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777
FH 328..400 CDD:238016 35/75 (47%)
fkh-8NP_001254107.1 COG5025 30..>217 CDD:227358 43/142 (30%)
FH 74..156 CDD:214627 36/82 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4184
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.