DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxP and FOXR2

DIOPT Version :10

Sequence 1:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_940853.1 Gene:FOXR2 / 139628 HGNCID:30469 Length:311 Species:Homo sapiens


Alignment Length:193 Identity:46/193 - (23%)
Similarity:76/193 - (39%) Gaps:42/193 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 RKDVPGREGKFCRSPLTVNSIGRPIRQTNSPSPLNLPMVNSTN---LCSIKKRNHDKNTFSINGG 299
            :||    ||..|.....|.|:.   ..::..|||....::|.:   |...:....|.|:......
Human   115 QKD----EGSNCSEDKVVESLP---SSSSEQSPLQKQGIHSPSDFELTEEEAEEPDDNSLQSPEM 172

  Fly   300 LPYMLERAGLDVQQEIHRNREFYKNADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCY 364
            ..|..::.     .:|:...:.::    |||...:.||..|:.::|...|::.||||:.:..|.:
Human   173 KCYQSQKL-----WQINNQEKSWQ----RPPLNCSHLIALALRNNPHCGLSVQEIYNFTRQHFPF 228

  Fly   365 FRRNAATWKNAIRTNLSLHKCFVRYEDDFGSFWMVDDNEFVKRRHLSRGRPRKYEPSSSPNSC 427
            |......||:.|..||    ||:      .||..|.|:             .|.|.::.|.||
Human   229 FWTAPDGWKSTIHYNL----CFL------DSFEKVPDS-------------LKDEDNARPRSC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:465036
FH_FOX 327..408 CDD:469596 25/80 (31%)
FOXR2NP_940853.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..76
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..171 14/62 (23%)
FH_FOXR 190..278 CDD:410810 30/106 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.