DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxP and FOXP4

DIOPT Version :9

Sequence 1:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_011512591.1 Gene:FOXP4 / 116113 HGNCID:20842 Length:687 Species:Homo sapiens


Alignment Length:387 Identity:158/387 - (40%)
Similarity:193/387 - (49%) Gaps:96/387 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 HPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESHLQKERDRLQA 219
            |||:.||.|:|||||...||:..|:|||||||.||||||||.|||||||.|||..|.||.:||||
Human   308 HPLYGHGECKWPGCETLCEDLGQFIKHLNTEHALDDRSTAQCRVQMQVVQQLEIQLAKESERLQA 372

  Fly   220 MMHHLYLSKQLLSPTKIDRKDVPGREGKFCRSPLTVNS-------IGRPIRQTNSP-SPLNLPMV 276
            ||.||::......|.......||| ...|  |.:||::       :..|.....:| :||..|.:
Human   373 MMAHLHMRPSEPKPFSQPLNPVPG-SSSF--SKVTVSAADSFPDGLVHPPTSAAAPVTPLRPPGL 434

  Fly   277 NSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLD-----VQQEIHRNREFYKNADVRPPFTYASL 336
            .|.               |::||.|  ..|...|     :..|:.:|.|||||||||||||||||
Human   435 GSA---------------SLHGGGP--ARRRSSDKFCSPISSELAQNHEFYKNADVRPPFTYASL 482

  Fly   337 IRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVRYEDDFGSFWMVDD 401
            |||||:::||:|||||||||||...|.|||||.||||||:|.||||||||||.|:..|:.|.||:
Human   483 IRQAILETPDRQLTLNEIYNWFTRMFAYFRRNTATWKNAVRHNLSLHKCFVRVENVKGAVWTVDE 547

  Fly   402 NEFVKRR----------------HLSRGR-PRKYEPS---------SSPNSCQSGN--------- 431
            .|:.|||                .||.|. ...|:.:         :||.....|:         
Human   548 REYQKRRPPKMTGSPTLVKNMISGLSYGALNASYQAALAESSFPLLNSPGMLNPGSASSLLPLSH 612

  Fly   432 ---GVPTDKNPCDNCTQHCTSLPP-------------------------GADNPLDSNNPND 465
               |.|.:..|.:..:......||                         ||.||..|..|.|
Human   613 DDVGAPVEPLPSNGSSSPPRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPED 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 46/66 (70%)
FH 328..400 CDD:238016 53/71 (75%)
FOXP4XP_011512591.1 FOXP-CC 310..377 CDD:292777 46/66 (70%)
Forkhead 474..553 CDD:278670 56/78 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5407
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001519
OrthoInspector 1 1.000 - - otm41385
orthoMCL 1 0.900 - - OOG6_103982
Panther 1 1.100 - - O PTHR45796
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4064
SonicParanoid 1 1.000 - - X957
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.