DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FoxP and Foxp2

DIOPT Version :9

Sequence 1:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_036021645.1 Gene:Foxp2 / 114142 MGIID:2148705 Length:740 Species:Mus musculus


Alignment Length:371 Identity:159/371 - (42%)
Similarity:202/371 - (54%) Gaps:75/371 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 SYMHDEFAMRKYYHPLFAHGICRWPGCEMDLEDITSFVKHLNTEHGLDDRSTAQARVQMQVVSQL 206
            |..|:|....   |.|:.||:|:|||||...||...|:||||.||.||||||||.|||||||.||
Mouse   355 SSSHEETGAS---HTLYGHGVCKWPGCESICEDFGQFLKHLNNEHALDDRSTAQCRVQMQVVQQL 416

  Fly   207 ESHLQKERDRLQAMMHHLYLSK----------QLLSPTKIDRKDVPGREGKFCRSPLTVNSIGRP 261
            |..|.|||:||||||.||::..          .|:|...:.:..:........::|.|..:...|
Mouse   417 EIQLSKERERLQAMMTHLHMRPSEPKPSPKPLNLVSSVTMSKNMLETSPQSLPQTPTTPTAPVTP 481

  Fly   262 IRQTNSPS---PLNLPMVNSTNLCSIKKRNHDKNTFSINGGLPYMLERAGLDVQQEIHRNREFYK 323
            |  |..||   |.::|     |:.:|::|:.||               ..:.:..||..|.||||
Mouse   482 I--TQGPSVITPASVP-----NVGAIRRRHSDK---------------YNIPMSSEIAPNYEFYK 524

  Fly   324 NADVRPPFTYASLIRQAIIDSPDKQLTLNEIYNWFQNTFCYFRRNAATWKNAIRTNLSLHKCFVR 388
            |||||||||||:||||||::|.|:||||||||:||..||.||||||||||||:|.||||||||||
Mouse   525 NADVRPPFTYATLIRQAIMESSDRQLTLNEIYSWFTRTFAYFRRNAATWKNAVRHNLSLHKCFVR 589

  Fly   389 YEDDFGSFWMVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQSGNGVPT-DKN-PCDNCTQHCTSLP 451
            .|:..|:.|.||:.|:.|||                  .|...|.|| .|| |        |||.
Mouse   590 VENVKGAVWTVDEVEYQKRR------------------SQKITGSPTLVKNIP--------TSLG 628

  Fly   452 PGADNPLDSNNPNDLGRIGCLPYCGSDGLSKASKDYSNMDSGMIES 497
            .||  .|:::....|.. ..||...:.||      .:|..||::::
Mouse   629 YGA--ALNASLQAALAE-SSLPLLSNPGL------INNASSGLLQA 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 46/66 (70%)
FH 328..400 CDD:238016 53/71 (75%)
Foxp2XP_036021645.1 FOXP-CC 367..434 CDD:406546 46/66 (70%)
COG5025 502..>733 CDD:227358 94/214 (44%)
FH_FOXP2 528..609 CDD:410839 58/80 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5382
eggNOG 1 0.900 - - E2759_KOG4385
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4184
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001519
OrthoInspector 1 1.000 - - otm43440
orthoMCL 1 0.900 - - OOG6_103982
Panther 1 1.100 - - O PTHR45796
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X957
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.720

Return to query results.
Submit another query.