DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hyd and UBE3B

DIOPT Version :9

Sequence 1:NP_001287262.1 Gene:hyd / 41181 FlyBaseID:FBgn0002431 Length:2887 Species:Drosophila melanogaster
Sequence 2:NP_569733.2 Gene:UBE3B / 89910 HGNCID:13478 Length:1068 Species:Homo sapiens


Alignment Length:724 Identity:150/724 - (20%)
Similarity:278/724 - (38%) Gaps:186/724 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  2257 YQKSTSDHLLLFPARGSQ--------------FYQSNFSELPSWNFLLSRWKLTLDLFGRVFMDD 2307
            :|||.|...:|.|..|.:              .||::.:       .|::.:|.: |.|..::||
Human   434 FQKSASVRNILRPVGGKRVDSAEVQKVCNICVLYQTSLT-------TLTQIRLQI-LTGLTYLDD 490

  Fly  2308 VGMEHGSVLPELRGFPVKEM----RFRRHMEKLRNGQQRD-------LVLCKLERNRESLI--VQ 2359
                   :||:|..| :.|:    ..:..:|.|.|..:..       ::.|...|:..:::  ::
Human   491 -------LLPKLWAF-ICELGPHGGLKLFLECLNNDTEESKQLLAMLMLFCDCSRHLITILDDIE 547

  Fly  2360 TFKELNTQFGNQSRRIQPPITFNRVKVTFK-DEPGEGSGVARSF-YTSIAEALLASAKIPNLESV 2422
            .::|                     :::|| :|....|....|| :..|.:.::.:||...||..
Human   548 VYEE---------------------QISFKLEELVTISSFLNSFVFKMIWDGIVENAKGETLELF 591

  Fly  2423 QVGTNHSKYVVPFSSILRSRTVSGSSRDQSTLQRRGSNSKILWRSA---RERKALNLDARPYTPP 2484
            |  :.|...:|.:....|.|..     .:....|:.....:|::..   |:|..|.|...|:..|
Human   592 Q--SVHGWLMVLYERDCRRRFT-----PEDHWLRKDLKPSVLFQELDRDRKRAQLILQYIPHVIP 649

  Fly  2485 N---------------------SSDNATPESLNDHLSVHLQQIGERLYPKIHSINQTHAPKITGM 2528
            :                     .:.:|:|..  .|:::...::.|..|.::..::| ||.|   .
Human   650 HKNRVLLFRTMVTKEKEKLGLVETSSASPHV--THITIRRSRMLEDGYEQLRQLSQ-HAMK---G 708

  Fly  2529 LLEIPTPQLLSV----ISSDETLRQKVNEAIEIITFKQKSETSAQSSQPKKSPSVVVVDPVDDDN 2589
            ::.:.....|.|    |..|...::.:.|.|:.:.                .|::.:......| 
Human   709 VIRVKFVNDLGVDEAGIDQDGVFKEFLEEIIKRVF----------------DPALNLFKTTSGD- 756

  Fly  2590 EPLFYSPGKRGFYTPRQGFASFERINAFRNIGRLIGLCLLQNELLPLFLQRHVLKYILGRKIKFH 2654
            |.|:.||         ..:.....:..|..:|:::|..:.:..::.:......|..:||.    |
Human   757 ERLYPSP---------TSYIHENYLQLFEFVGKMLGKAVYEGIVVDVPFASFFLSQLLGH----H 808

  Fly  2655 DLAFFD-----PALYESFRQIIQNAQTKEGEETINRMELCFVIDLMKEEGCGNRELIPGGRDVAV 2714
            ...|:.     |:|...|.:.:.:.:..:|:.|...:.|.:..|:|.:..|  .||||||:.:.|
Human   809 HSVFYSSVDELPSLDSEFYKNLTSIKRYDGDITDLGLTLSYDEDVMGQLVC--HELIPGGKTIPV 871

  Fly  2715 TSSNIFEYVRRYTEYRL---IKSQEKALEALKDGVFDVL-PDNSMINLTAEDLRLLLNGVGDINV 2775
            |:.|...|:.....:|:   ||:|..||.:   |...:: |:...:..|.|..||:.....:|::
Human   872 TNENKISYIHLMAHFRMHTQIKNQTAALIS---GFRSIIKPEWIRMFSTPELQRLISGDNAEIDL 933

  Fly  2776 STLISYTTFNDESSEGPDKLLKFKKWFWSIV-EKMNIMERQDLVYFWTGSPALPASEEGFQPL-P 2838
            ..|..:|.:.. ...|..:::   .|.|.|: ......||...:.|.|.....|..  ||..| |
Human   934 EDLKKHTVYYG-GFHGSHRVI---IWLWDILASDFTPDERAMFLKFVTSCSRPPLL--GFAYLKP 992

  Fly  2839 SVTIR---PADD-----------------------SHLPTANTCISRLYIPLYSSKSILRSKMLM 2877
            ..:||   .:||                       ..|||::||.:.|.:|.||.||:||.|:..
Human   993 PFSIRCVEVSDDQDTGDTLGSVLRGFFTIRKREPGGRLPTSSTCFNLLKLPNYSKKSVLREKLRY 1057

  Fly  2878 AIKSKNFGF 2886
            || |.|.||
Human  1058 AI-SMNTGF 1065

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hydNP_001287262.1 E3_UbLigase_EDD 150..196 CDD:288409
ZnF_UBR1 1217..1284 CDD:197698
ASF1_hist_chap 1535..1733 CDD:304562
PolyA 2498..2561 CDD:197769 13/66 (20%)
HECTc 2589..2885 CDD:238033 81/332 (24%)
HECTc 2589..2884 CDD:214523 80/331 (24%)
UBE3BNP_569733.2 HECTc 682..1066 CDD:238033 98/430 (23%)
HECTc 707..1065 CDD:214523 90/402 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.