DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hyd and HUL4

DIOPT Version :9

Sequence 1:NP_001287262.1 Gene:hyd / 41181 FlyBaseID:FBgn0002431 Length:2887 Species:Drosophila melanogaster
Sequence 2:NP_012570.3 Gene:HUL4 / 853494 SGDID:S000003797 Length:892 Species:Saccharomyces cerevisiae


Alignment Length:333 Identity:86/333 - (25%)
Similarity:144/333 - (43%) Gaps:50/333 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  2574 KKSPSVVVVDPVDDDNEPLFYSPGKRGFYTPRQGFASFERINAFRNIGRLIGLCLLQNELLPLFL 2638
            :.|.|...:||.:.|.     |.||.            .::..:...|.::||.:..:.:|.|..
Yeast   589 ESSRSWFAIDPPNFDK-----SKGKN------------SQLELYYLFGVVMGLAIFNSTILDLQF 636

  Fly  2639 QRHVLKYILGRKIKFHDLAFFDPALYESFRQIIQNAQTKEGE---------ETINRMELCFVIDL 2694
            .:.:.|.:....:.|.|.:...|   |:.|.:|:.....|..         ||..|.....:.|.
Yeast   637 PKALYKKLCSEPLSFEDYSELFP---ETSRNLIKMLNYTEDNFEDVFSLTFETTYRNNNWILNDS 698

  Fly  2695 MKEEGCGNRELIPGGRDVAVTSSNIFEYVRRYTEYRLIKSQEKALEALKDGVFDVLPD-NSMINL 2758
            ...:.....||...||:|.:|.||..|:|.::.|:.|.||.|........|...|..: ||:...
Yeast   699 KSSKEYVTVELCENGRNVPITQSNKHEFVMKWVEFYLEKSIEPQYNKFVSGFKRVFAECNSIKLF 763

  Fly  2759 TAEDLRLLLNGVGD---INVSTLISYTT----FNDESSEGPDKLLKFKKWFWSIVEKMNIMERQD 2816
            .:|:|..|:.|..:   .:..:|.|.|.    |:|:|        :...|||.|:|..:...::.
Yeast   764 NSEELERLVCGDEEQTKFDFKSLRSVTKYVGGFSDDS--------RAVCWFWEIIESWDYPLQKK 820

  Fly  2817 LVYFWTGSPALPASEEGFQPLP-SVTIRPADDS-HLPTANTCISRLYIPLYSSKSILRSKMLMAI 2879
            |:.|.|.|..:||:  |...:| .:::..:.|| .||.|:||.:.:.:..||||..|..|:|.||
Yeast   821 LLQFVTASDRIPAT--GISTIPFKISLLGSHDSDDLPLAHTCFNEICLWNYSSKKKLELKLLWAI 883

  Fly  2880 -KSKNFGF 2886
             :|:.:||
Yeast   884 NESEGYGF 891

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hydNP_001287262.1 E3_UbLigase_EDD 150..196 CDD:288409
ZnF_UBR1 1217..1284 CDD:197698
ASF1_hist_chap 1535..1733 CDD:304562
PolyA 2498..2561 CDD:197769
HECTc 2589..2885 CDD:238033 79/315 (25%)
HECTc 2589..2884 CDD:214523 79/314 (25%)
HUL4NP_012570.3 HUL4 1..892 CDD:227354 86/333 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.