DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hyd and Arel1

DIOPT Version :9

Sequence 1:NP_001287262.1 Gene:hyd / 41181 FlyBaseID:FBgn0002431 Length:2887 Species:Drosophila melanogaster
Sequence 2:NP_001351118.1 Gene:Arel1 / 68497 MGIID:1915747 Length:823 Species:Mus musculus


Alignment Length:818 Identity:179/818 - (21%)
Similarity:288/818 - (35%) Gaps:252/818 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly  2172 SKYEKVVLMETDDSLPSTSK-----STEALMATRPEVI-IAPNKASVSPATAARSVIVLAGGSCL 2230
            |.|.|:  .:....:||.:|     ||..|...:|..: |.|.....:|...:.|:         
Mouse   152 SPYYKI--FQPGMVVPSKTKIVCHFSTLVLTCGQPHTLQIVPRDEYDNPTNNSMSL--------- 205

  Fly  2231 KTIDSDINNYSAS--NLSTAEQAKCDTQYQKSTSDHLLLFPARGSQFYQSNFSELPSWNFLLSRW 2293
                .|.::||.:  .|...|:...:..::||.:.:                             
Mouse   206 ----RDEHSYSLAIHELGPQEEENNEVSFEKSVTSN----------------------------- 237

  Fly  2294 KLTLDLFGRVFMDDVGMEHGSVLPELRGFPVKEMRFRRHMEKLRNGQQRDLVLCKLERNRESLIV 2358
            :.|..:|.|:.:...|..|..:              ....:.:.||:...:||.:.|:|    ||
Mouse   238 RQTCQVFLRLTLHSRGCFHACI--------------SYQNQPINNGEFDIIVLSENEKN----IV 284

  Fly  2359 QTFKELNTQFGNQSRRIQPPITFNRVKVTFKDEPGEGSGVARSFYTSIAEALLASAKIPNLESVQ 2423
            :  :.::|                             |||:..|     ||.|.:|.  |..|  
Mouse   285 E--RNVST-----------------------------SGVSIYF-----EAYLYNAN--NCTS-- 309

  Fly  2424 VGTNHSKYVVPFSSILRSRTVSGSSRDQSTLQRRGSNSKILWRSARERKALNLDARPYTPPNSSD 2488
                     .|:.  |....:|.|.|..||                   |:..|    ...:.|:
Mouse   310 ---------TPWH--LPPMHMSSSQRRPST-------------------AIEED----DEDSPSE 340

  Fly  2489 NATPESLNDHLSV--------------HLQQIGERLY-------PKIHSINQTHAPKITGMLLE- 2531
            ..|||.:.....|              :|:.|..|||       .|...:......|:..:::: 
Mouse   341 CHTPEKVKKPKKVYCYVSPKQFSVKEFYLKIIPWRLYTFRVCPGTKFSYLGPDPVHKLLTLVVDD 405

  Fly  2532 -IPTPQLLSV-----------------ISSDETLRQKVN----EAIEI--------ITFKQKSET 2566
             |..|..||.                 |...||.:.|||    |..::        :|.|.....
Mouse   406 GIQPPVELSCKERNILAATFIRSLHKNIGGSETFQDKVNFFQRELRQVHMKRPHSKVTLKVSRHA 470

  Fly  2567 SAQSSQPKKSPSVVVVD------PVDDDNEPLFYSPGKRGFY---------TPRQGFASFE---- 2612
            ..:||. |.:.:..:.|      .|..|.|.|.:...:|.::         |..|.||.|.    
Mouse   471 LLESSL-KATRNFSISDWSKNFEVVFQDEEALDWGGPRREWFELICKALFDTTSQLFARFTDSNQ 534

  Fly  2613 -------------RINAFRNIGRLIGLCLLQNELLPLFLQ-------RHVLKYILGRKIKFHDLA 2657
                         |:..:...|||:|.||.::.|...:.|       |..|..|:|.::.:....
Mouse   535 ALVHPNPNRPAHLRLKMYEFAGRLVGKCLYESSLGGAYKQLVRARFTRSFLAQIIGLRMHYKYFE 599

  Fly  2658 FFDPALYESFRQIIQNAQTKEGEETINRMELCFVIDLMKEEGCGNR--ELIPGGRDVAVTSSNIF 2720
            ..||..|:|....|.|....|       |||.|..:...:.|..::  ||:.||....||::|..
Mouse   600 TDDPEFYKSKVCFILNNDMSE-------MELVFAEEKYNKSGQLDKIVELMTGGAQTPVTNANKI 657

  Fly  2721 EYVRRYTEYRLIKSQEKALEALKDGVFDVLPDNSMINLTAEDLRLLLNGVGDINVSTLISYTTFN 2785
            .|:....:|||....::.:|....|:.:::|:|.:......:|.||:.|.||||||...::....
Mouse   658 FYLNLLAQYRLASQVKEEVEHFLKGLNELVPENLLAIFDENELELLMCGTGDINVSDFKAHAVVV 722

  Fly  2786 DESSEGPDKLLKFKKWFWSIVEKMNIMERQDLVYFWTGSPALPASEEGFQPL-PSVTIRPA-DDS 2848
            ..|....:|::   :|||::|..:...|...|:.|.|||..||..  ||..| ||..|..| ..|
Mouse   723 GGSWHFREKVM---RWFWAVVSSLTQEELARLLQFTTGSSQLPPG--GFAALCPSFQIIAAPTHS 782

  Fly  2849 HLPTANTCISRLYIPLYSSKSILRSKMLMAIKSKNFGF 2886
            .||||:||.::|.:|.|.|...:...:.:||.....||
Mouse   783 TLPTAHTCFNQLCLPTYDSYEEVHRMLQLAISEGCEGF 820

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hydNP_001287262.1 E3_UbLigase_EDD 150..196 CDD:288409
ZnF_UBR1 1217..1284 CDD:197698
ASF1_hist_chap 1535..1733 CDD:304562
PolyA 2498..2561 CDD:197769 20/114 (18%)
HECTc 2589..2885 CDD:238033 92/332 (28%)
HECTc 2589..2884 CDD:214523 92/331 (28%)
Arel1NP_001351118.1 Filamin 56..154 CDD:395505 1/1 (100%)
Filamin 64..158 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..345 9/52 (17%)
HECTc 464..821 CDD:238033 101/370 (27%)
Interaction with SOCS2. /evidence=ECO:0000250|UniProtKB:O15033 483..789 87/317 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.