DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hyd and Magix

DIOPT Version :9

Sequence 1:NP_001287262.1 Gene:hyd / 41181 FlyBaseID:FBgn0002431 Length:2887 Species:Drosophila melanogaster
Sequence 2:NP_061302.2 Gene:Magix / 54634 MGIID:1859644 Length:324 Species:Mus musculus


Alignment Length:321 Identity:63/321 - (19%)
Similarity:111/321 - (34%) Gaps:77/321 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   596 STAMPSTGSSKNGQSFSNS---KESTDRIDMPPPPSPASSTCSDTGSVTSHKRTKRATTK----- 652
            :||.|..|....|...|.|   ::..:|:|..|..:.|::      .:|:..|...||.:     
Mouse     7 NTADPRGGRRGGGLQGSRSPRARQLLERLDARPLAARAAA------DLTALVRKAGATLRLRHTE 65

  Fly   653 ------------EDSNAPQ--------EGRKDEEL--WEVKDVVFVEDKVGPVGKVLKVDGDFVA 695
                        .||..|.        :.::.|.|  | .:.:...::|.....||.:..|.|..
Mouse    66 GVSGLDSADIEVTDSRLPHATLVKHRPQHQRSETLGTW-TEPLPVTQNKASYALKVPQATGRFSV 129

  Fly   696 --VRFPAINAAAVAAAAAATSSTSNTASTSKEEGKEDDWQQCRLLRREDVQIFRTAMSTRGPDWL 758
              .|.||.....::.....:.....|.....::|..   |:|..|:..|:.::....||:|....
Mouse   130 ELTRGPAGFGLTLSGGRNVSGDAPLTVHGLLKDGPA---QRCGRLQAGDLVLYINGQSTQGLTHA 191

  Fly   759 QKQPKKINVGG-----------DAAGAQILTL--------AVDSRGIHV-IKKVLGKIHYSLYNL 803
            | ..::|..||           |..|::|..:        ::|.||..| .:..:..:|:.....
Mouse   192 Q-VVERIRTGGPHLCLVLQRPQDMDGSRIKEVGGHRKTDRSLDPRGSRVESRSTISPVHHRPKTR 255

  Fly   804 YNCKQEQNCL----------FPT-DCNSFIGSTPGNILMACNDDCSGNSSTIVLRDGNGAL 853
            .:.:.....:          .|| |..:.|..|||..|:...|..   |..:.:|.|...|
Mouse   256 TSPRPSPEAVAIGHVVRAVEHPTEDLENRIPGTPGPWLVPSEDRL---SRALGVRGGGAQL 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hydNP_001287262.1 E3_UbLigase_EDD 150..196 CDD:288409
ZnF_UBR1 1217..1284 CDD:197698
ASF1_hist_chap 1535..1733 CDD:304562
PolyA 2498..2561 CDD:197769
HECTc 2589..2885 CDD:238033
HECTc 2589..2884 CDD:214523
MagixNP_061302.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 6/18 (33%)
PDZ 126..211 CDD:214570 17/88 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..263 7/46 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.