DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hyd and ASCC1

DIOPT Version :9

Sequence 1:NP_001287262.1 Gene:hyd / 41181 FlyBaseID:FBgn0002431 Length:2887 Species:Drosophila melanogaster
Sequence 2:NP_001185728.1 Gene:ASCC1 / 51008 HGNCID:24268 Length:400 Species:Homo sapiens


Alignment Length:292 Identity:61/292 - (20%)
Similarity:102/292 - (34%) Gaps:94/292 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   725 EEG----KEDDWQQCRLLRREDVQIFRTAMSTRGPDWLQKQPKKINVGGDAAGAQILTLAVDSRG 785
            :||    :|:...:|.:....|..||             :.|||::          ||:     |
Human   175 QEGFLRFQEEVLAKCSMDHGVDSSIF-------------QNPKKLH----------LTI-----G 211

  Fly   786 IHVIKKVLGKIHYSLYNLYNCKQEQNCLFPTDCNSFIGSTPGNILMA----CNDDCSGNSSTIV- 845
            :.|:... .:|..:...|..||:|       ..|...|..|..:.||    .||| .|....:. 
Human   212 MLVLLSE-EEIQQTCEMLQQCKEE-------FINDISGGKPLEVEMAGIEYMNDD-PGMVDVLYA 267

  Fly   846 ---LRDGNGALYPLAKDCL-----GSIKDPQWFDLPPVKSITMSTI--SLPAMLSGVNLKSK--- 897
               ::||:..|..|....|     ..:...:|..: .:.:..|:|:  ..|......||.:.   
Human   268 KVHMKDGSNRLQELVDRVLERFQASGLIVKEWNSV-KLHATVMNTLFRKDPNAEGRYNLYTAEGK 331

  Fly   898 -VCMTALLFDTQKLMPHILRCDVKNSFAALGRLEREDQADTALVVEERCDGARNIFHACVIMCAP 961
             :......||.:.::         .|||.|.|||..|      .:...|:           :|.|
Human   332 YIFKERESFDGRNIL---------KSFALLPRLEYND------AISAHCN-----------LCLP 370

  Fly   962 SSNKDSPPDSPSGGVEKKSLVGLSVA--RSIP 991
            .|:     |||:...:...:.|:|.|  :|:|
Human   371 GSS-----DSPASASQVAGITGVSDAYSQSLP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hydNP_001287262.1 E3_UbLigase_EDD 150..196 CDD:288409
ZnF_UBR1 1217..1284 CDD:197698
ASF1_hist_chap 1535..1733 CDD:304562
PolyA 2498..2561 CDD:197769
HECTc 2589..2885 CDD:238033
HECTc 2589..2884 CDD:214523
ASCC1NP_001185728.1 Required for interaction with ASCC3. /evidence=ECO:0000269|PubMed:29997253 1..53
vigilin_like_KH 99..148 CDD:239087
PLN00108 157..370 CDD:177724 51/258 (20%)
AKAP7_NLS 161..349 CDD:287446 41/220 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.