DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hyd and Herc4

DIOPT Version :10

Sequence 1:NP_001287262.1 Gene:hyd / 41181 FlyBaseID:FBgn0002431 Length:2887 Species:Drosophila melanogaster
Sequence 2:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster


Alignment Length:282 Identity:80/282 - (28%)
Similarity:130/282 - (46%) Gaps:17/282 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  2610 SFERINAFRNIGRLIGLCLLQNELLPLFLQRHVLKYILGRKIKFHDLAFFDPALYESFRQIIQNA 2674
            :||..|.:..||.|.||.:....::.|.....:.|.:||:.:...||....|....|.:.::.  
  Fly   794 TFETENMYFLIGVLCGLAIYNFTIINLPFPLALFKKLLGKPVDLSDLRQLSPPEANSMQSLLD-- 856

  Fly  2675 QTKEGEETINRMELCFVI--DLMKEEGCGNRELIPGGRDVAVTSSNIFEYVRRYTEYRLIKSQEK 2737
              .:|::.....:|.|.|  |:..|  ...:.|.|.|.::|||..|..|:|..|.::...||.|.
  Fly   857 --YQGDDFKEVFDLTFEISRDVFGE--AETKCLKPNGNEIAVTLENRQEFVDLYVDFVFNKSVEL 917

  Fly  2738 ALEALKDGVFDVLPDNSMINLTAEDLRLLLNGVGDINVSTLISYTTFNDESSEGPDKLLKFKKWF 2802
            ...|...|...|.....:.....|:|..::.|..|.:...|..    |.|..||...:....|||
  Fly   918 HYNAFHKGFMKVCSGRVIHIFQPEELMAVVVGNEDYDWQALQD----NCEYREGYTSVDDTIKWF 978

  Fly  2803 WSIVEKMNIMERQDLVYFWTGSPALPASEEGFQPLPSVTIRPA-DDSHLPTANTCISRLYIPLYS 2866
            |.::..|:..|::..:.|.|||..:|.  :|.:.| .:||:|. |:..||.|:||.:.|.:|.|.
  Fly   979 WEVIHDMSEAEKKSFLLFLTGSDRIPI--QGMKAL-KLTIQPTPDERFLPVAHTCFNLLDLPRYK 1040

  Fly  2867 SKSILRSKMLMAI-KSKNFGFV 2887
            :|..|:.|:|.|| :::.|..|
  Fly  1041 TKERLKYKLLQAIQQTQGFSLV 1062

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hydNP_001287262.1 UBA_like_SF 150..196 CDD:473871
UBR-box_UBR5 1211..1286 CDD:439073
MDN1 <1551..>1724 CDD:444083
PolyA 2498..2561 CDD:197769
HECTc 2589..2884 CDD:214523 78/277 (28%)
Herc4NP_001261249.1 ATS1 7..352 CDD:444065
RCC1 327..390 CDD:395335
HECTc 715..1060 CDD:238033 78/278 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.