DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hyd and yki

DIOPT Version :9

Sequence 1:NP_001287262.1 Gene:hyd / 41181 FlyBaseID:FBgn0002431 Length:2887 Species:Drosophila melanogaster
Sequence 2:NP_001350857.1 Gene:yki / 37851 FlyBaseID:FBgn0034970 Length:418 Species:Drosophila melanogaster


Alignment Length:482 Identity:94/482 - (19%)
Similarity:173/482 - (35%) Gaps:125/482 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 LVTVPATYVPEELISQAEVVLQGKSRNLIIRELQRTNLDVNLAVNNLLSRDDEEAEDTEEGADNY 211
            |.|:.|.|:...:.:.:      .:.:||.:|:...::...:..|||:.|.:::.:|        
  Fly    16 LYTISAFYMLTTMSASS------NTNSLIEKEIDDEDMLSPIKSNNLVVRVNQDTDD-------- 66

  Fly   212 VPEDLISLLDNGFSGDNNSVIIDPSDGLFSEEIFSNYSSIRNLLFDRIRSERSNANANAADS--- 273
               :|.:|.|:         :::|.|.....::......:.|..|  .....|::.||:|||   
  Fly    67 ---NLQALFDS---------VLNPGDAKRPLQLPLRMRKLPNSFF--TPPAPSHSRANSADSTYD 117

  Fly   274 --NQSTTRSTSSGTAL---TGNSGLSA------QISVNADREAFSRWRDR-------QYYGPRRW 320
              :||:....:..:.:   .|.|.::|      |.|....|.|....|.|       |.|..|. 
  Fly   118 AGSQSSINIGNKASIVQQPDGQSPIAAIPQLQIQPSPQHSRLAIHHSRARSSPASLQQNYNVRA- 181

  Fly   321 ISKDDYTWEKDADSKKKEPSPMLSPIWISEELQP----WPEKSSVRFKTIGALYSEFIALSESGD 381
                    ..||.:..   :|..:|   |.:.||    :||.|:..|.: ||..|..|.|    |
  Fly   182 --------RSDAAAAN---NPNANP---SSQQQPAGPTFPENSAQEFPS-GAPASSAIDL----D 227

  Fly   382 LYQWRWSDAEPYKSETENVYHPKTVSLNIVERVEL-------------ISANFIRCSVVTETNRV 433
            ......|...|...:|   .|.|..|.:::..::|             ...|..:...:..|.:.
  Fly   228 AMNTCMSQDIPMSMQT---VHKKQRSYDVISPIQLNRQLGALPPGWEQAKTNDGQIYYLNHTTKS 289

  Fly   434 ATWMDEQLGYIGAKLEHSCCAFNEFISDSITKIYVCSLYTVVKTESNNIYWWGVLPFDQRRFLWD 498
            ..|.|.::.|    .:.......|.|..:  .:...:..|...|.:||:   |.||..     |:
  Fly   290 TQWEDPRIQY----RQQQQILMAERIKQN--DVLQTTKQTTTSTIANNL---GPLPDG-----WE 340

  Fly   499 KFRTKTKKPFKVVATDINVGAQVIMKKCPMYQSGSIGFTCSNGVPKVGQLLNSVWTFTDVCRMKI 563
            :..|::...:.:...|     :......|..|||.....|.:      .|::|:....::|    
  Fly   341 QAVTESGDLYFINHID-----RTTSWNDPRMQSGLSVLDCPD------NLVSSLQIEDNLC---- 390

  Fly   564 ININTNSGVDKSQAAGNNLNAHGITPD 590
                 ::..:.:||..|..::|  .||
  Fly   391 -----SNLFNDAQAIVNPPSSH--KPD 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hydNP_001287262.1 E3_UbLigase_EDD 150..196 CDD:288409 8/45 (18%)
ZnF_UBR1 1217..1284 CDD:197698
ASF1_hist_chap 1535..1733 CDD:304562
PolyA 2498..2561 CDD:197769
HECTc 2589..2885 CDD:238033
HECTc 2589..2884 CDD:214523
ykiNP_001350857.1 HUL4 <261..>404 CDD:227354 28/176 (16%)
WW 266..295 CDD:395320 3/28 (11%)
WW 335..364 CDD:395320 5/38 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.