DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hyd and Magix

DIOPT Version :9

Sequence 1:NP_001287262.1 Gene:hyd / 41181 FlyBaseID:FBgn0002431 Length:2887 Species:Drosophila melanogaster
Sequence 2:NP_001014131.1 Gene:Magix / 317379 RGDID:1549729 Length:326 Species:Rattus norvegicus


Alignment Length:274 Identity:49/274 - (17%)
Similarity:100/274 - (36%) Gaps:79/274 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   578 AGNNLNAHGITPDKDLPKSTAMPSTGSSKNGQSFSNSKESTDRIDMPPPPSPASSTCS---DTGS 639
            |||..:..|..      :...:..:||.:       :::..:|:|..|..:.|::..|   ....
  Rat     5 AGNTADPRGSR------RGVGLQGSGSPR-------ARQLLERLDARPLAARAAADLSALVRKAG 56

  Fly   640 VTSHKRTKRATTKEDS-----------------NAPQEGRKDEELWEVKDVVFVEDKVGPVGKVL 687
            .|...|.|.|.:..||                 :.||..|.|.:...::.:..:::|.....::.
  Rat    57 ATLRLRHKEAISGLDSADIEVADSRLPHATLVEHRPQHQRSDTQGPRMEPLPVIQNKASYASRLP 121

  Fly   688 KVDGDFVA--VRFPAINAAAVAAAAAATSSTSNTASTSKEEGKEDDWQQCRLLRREDVQIFRTAM 750
            :..|.|..  ||.||.....::.....:.:.........::|..   |:|..|:..|:.::....
  Rat   122 QATGRFSVELVRGPAGFGLTLSGGRNVSGNVPLAVCGLLKDGPA---QRCGHLQAGDLVLYINGQ 183

  Fly   751 STRG------PDWLQ----------KQPKKIN------VGG---------DAAGAQILTLAVDSR 784
            ||||      .:|::          ::|:::|      |||         |..|.:::    :||
  Rat   184 STRGLTHAQAVEWIRTGGPRLCLVLQRPQEMNGSRSKEVGGGHQKTDRIPDPRGGRMM----ESR 244

  Fly   785 GIHVIKKVLGKIHY 798
            |      .:..:|:
  Rat   245 G------TISPVHH 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hydNP_001287262.1 E3_UbLigase_EDD 150..196 CDD:288409
ZnF_UBR1 1217..1284 CDD:197698
ASF1_hist_chap 1535..1733 CDD:304562
PolyA 2498..2561 CDD:197769
HECTc 2589..2885 CDD:238033
HECTc 2589..2884 CDD:214523
MagixNP_001014131.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 6/39 (15%)
PDZ_signaling 127..209 CDD:238492 15/84 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..267 10/49 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.