DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment hyd and Bag3

DIOPT Version :9

Sequence 1:	NP_001287262.1	Gene:	hyd / 41181	FlyBaseID:	FBgn0002431	Length:	2887	Species:	Drosophila melanogaster
Sequence 2:	NP_001011936.1	Gene:	Bag3 / 293524	RGDID:	1307794	Length:	574	Species:	Rattus norvegicus

Alignment Length:	140	Identity:	39/140 - (27%)
Similarity:	57/140 - (40%)	Gaps:	46/140 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly  1017 FATMSSSAAGSASSTSRDNRTNLRDMMNRLINSDQAEQSGSQP-MATNNEDHAYIPWPAETPAAS 1080
            |.|.:::||...|      ::.||..:.....:|  :|.|..| .||.....|:.|..:::||||
  Rat   124 FRTEAAAAAPQRS------QSPLRGGVTETTQTD--KQCGQVPAAATAQPPTAHGPERSQSPAAS 180

  Fly  1081 NLSASSSQNVSDSIEDDISKIIPSSSQSSMLSNIKLGSPTYTFDLAQRREHAL--------TILQ 1137
            :.|:|||           |..:|||.:||      |||            |.|        .|.:
  Rat   181 DCSSSSS-----------SASLPSSGRSS------LGS------------HQLPRGYIPIPVIHE 216

  Fly  1138 QMCVSPALRP 1147
            |....||.:|
  Rat   217 QNITRPAAQP 226

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
hyd	NP_001287262.1	E3_UbLigase_EDD	150..196	CDD:288409
		ZnF_UBR1	1217..1284	CDD:197698
		ASF1_hist_chap	1535..1733	CDD:304562
		PolyA	2498..2561	CDD:197769
		HECTc	2589..2885	CDD:238033
		HECTc	2589..2884	CDD:214523
Bag3	NP_001011936.1	WW	23..55	CDD:197736
Bag3	NP_001011936.1	BAG	423..500	CDD:214591
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5021
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900