DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hyd and HERC4

DIOPT Version :9

Sequence 1:NP_001287262.1 Gene:hyd / 41181 FlyBaseID:FBgn0002431 Length:2887 Species:Drosophila melanogaster
Sequence 2:XP_011537894.1 Gene:HERC4 / 26091 HGNCID:24521 Length:1081 Species:Homo sapiens


Alignment Length:393 Identity:95/393 - (24%)
Similarity:162/393 - (41%) Gaps:45/393 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  2516 SINQTHAPKITGMLL---EIPTPQLLSVISSDETLRQKVNEAIEIITFKQKSETSAQSSQPKKSP 2577
            :|:|.|...::.:.|   |...|.|:.|:..:..    |.:|:|::       ...::...||..
Human   709 AIDQAHRQNVSSLFLPVIESVNPCLILVVRRENI----VGDAMEVL-------RKTKNIDYKKPL 762

  Fly  2578 SVVVV--DPVDDDN-EPLFYSPGKRGFYTPRQGF--------------ASFERINAFRNIGRLIG 2625
            .|:.|  |.||... ...|:....|....|:.|.              .:||..:.|..||.:.|
Human   763 KVIFVGEDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSRLIWFSDKTFEDSDLFHLIGVICG 827

  Fly  2626 LCLLQNELLPLFLQRHVLKYILGRKIKFHDLAFFDPALYESFRQIIQNAQTKEGEETINRMELCF 2690
            |.:....::.|.....:.|.:|.:|....||....|.:..|.:|::...: .:.|||..   |.|
Human   828 LAIYNCTIVDLHFPLALYKKLLKKKPSLDDLKELMPDVGRSMQQLLDYPE-DDIEETFC---LNF 888

  Fly  2691 VIDLMKEEGCGNRELIPGGRDVAVTSSNIFEYVRRYTEYRLIKSQEKALEALKDGVFDVLPDNSM 2755
            .|.:........:||:..|.|.||...|..|:|..|.:|...||.....:|...|...|.....:
Human   889 TITVENFGATEVKELVLNGADTAVNKQNRQEFVDAYVDYIFNKSVASLFDAFHAGFHKVCGGKVL 953

  Fly  2756 INLTAEDLRLLLNGVGDINVSTLISYTTFNDES-SEGPDKLLKFKKWFWSIVEKMNIMERQDLVY 2819
            :.....:|:.::.|..:.:...|...|.:..|. :|.|.     .|.||.:..::.:.:::..:.
Human   954 LLFQPNELQAMVIGNTNYDWKELEKNTEYKGEYWAEHPT-----IKIFWEVFHELPLEKKKQFLL 1013

  Fly  2820 FWTGSPALPASEEGFQPLPSV-TIRPADDSHLPTANTCISRLYIPLYSSKSILRSKMLMAIKSKN 2883
            |.|||..:|..  |.:.|..| ......:.:||.::||.:.|.:|.|:.|..||||::.|| ..|
Human  1014 FLTGSDRIPIL--GMKSLKLVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAI-DHN 1075

  Fly  2884 FGF 2886
            .||
Human  1076 EGF 1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hydNP_001287262.1 E3_UbLigase_EDD 150..196 CDD:288409
ZnF_UBR1 1217..1284 CDD:197698
ASF1_hist_chap 1535..1733 CDD:304562
PolyA 2498..2561 CDD:197769 11/47 (23%)
HECTc 2589..2885 CDD:238033 75/312 (24%)
HECTc 2589..2884 CDD:214523 74/311 (24%)
HERC4XP_011537894.1 RCC1 2..368 CDD:332518
HECTc 733..1079 CDD:238033 89/369 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.