DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hyd and Gas7

DIOPT Version :9

Sequence 1:NP_001287262.1 Gene:hyd / 41181 FlyBaseID:FBgn0002431 Length:2887 Species:Drosophila melanogaster
Sequence 2:XP_006532265.1 Gene:Gas7 / 14457 MGIID:1202388 Length:476 Species:Mus musculus


Alignment Length:337 Identity:65/337 - (19%)
Similarity:115/337 - (34%) Gaps:93/337 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VVIGPAHIGVLLEDGKAFRVSFSINSEKLDLTKSDAKCSTSGGSGTAS---------ASKAPSSS 105
            |::.|.....|...|:.:.|:.:.|....:...|....|.|.|...:|         ||..|  :
Mouse    77 VILPPGWHSYLSPQGRRYYVNTTTNETTWERPSSSPGISASPGPHRSSLPTTVNGYHASGTP--A 139

  Fly   106 RPMARSRARLLRATGRSNSTGQGS----GSRSTGVIIGGSTSSRPLVTVP--------------- 151
            .|...:...|.::||.|.:.|..|    .|:...:.|...|...| .|:|               
Mouse   140 HPPETAHMSLRKSTGDSQNLGSSSPGRKQSKENTITINCVTFPHP-DTMPEQQLLKPTEWSYCDY 203

  Fly   152 -----------ATYVPEELISQAEVVLQGKSRNLIIRELQRTNLDV---------NLAVNNLLSR 196
                       .|....||:.|.:  |:||.....:.|..|..:.:         .|:.|:|.::
Mouse   204 FWADKKDPQGNGTVAGFELLLQKQ--LKGKQMQKEMSEFIRERIKIEEEYAKNLAKLSQNSLAAQ 266

  Fly   197 DD---------------EEAE---DTEEGADNYVPEDLISLLDNGFSGDNNSVIIDPSDGLFSEE 243
            ::               :|||   .......:.|.:.|::..:| |..|........:|  ..::
Mouse   267 EEGSLGEAWAQVKKSLADEAEVHLKFSAKLHSEVEKPLMNFREN-FKKDMKKCDHHIAD--LRKQ 328

  Fly   244 IFSNYSSI---RNLLFDRIRS--------ERSNANANAADSNQSTTRSTSSGTALTGNSGLSAQI 297
            :.|.|:|:   |..|.:|.:.        |...:|....|..::..:||.:|..|        ..
Mouse   329 LASRYASVEKARKALTERQKDLEMKTQQLEIKLSNKTEEDIKKARRKSTQAGDDL--------MR 385

  Fly   298 SVNADREAFSRW 309
            .|:...:|.|:|
Mouse   386 CVDLYNQAQSKW 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hydNP_001287262.1 E3_UbLigase_EDD 150..196 CDD:288409 13/80 (16%)
ZnF_UBR1 1217..1284 CDD:197698
ASF1_hist_chap 1535..1733 CDD:304562
PolyA 2498..2561 CDD:197769
HECTc 2589..2885 CDD:238033
HECTc 2589..2884 CDD:214523
Gas7XP_006532265.1 SH3_GAS7 5..57 CDD:212763
WW_FCH_linker 109..201 CDD:374680 21/94 (22%)
F-BAR_GAS7 214..446 CDD:153333 38/197 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.