DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment hyd and YAP1

DIOPT Version :9

Sequence 1:NP_001287262.1 Gene:hyd / 41181 FlyBaseID:FBgn0002431 Length:2887 Species:Drosophila melanogaster
Sequence 2:XP_005271435.1 Gene:YAP1 / 10413 HGNCID:16262 Length:510 Species:Homo sapiens


Alignment Length:579 Identity:107/579 - (18%)
Similarity:178/579 - (30%) Gaps:208/579 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1886 PNHPLHPLNLSAQASSSQTPAPATSSSVNGVNIMGSNSRRDFFTYCLSLMRSHTSEHRDALPVLD 1950
            |:.|..|...:.||:....||......|.|      :|..|......::|...|:.....:|:  
Human    30 PSGPGQPAPAATQAAPQAPPAGHQIVHVRG------DSETDLEALFNAVMNPKTANVPQTVPM-- 86

  Fly  1951 ITALRHIAYVLDAFVYYMRNDSGFYDKQ-DTISGRINNLSPMTESYDTDDELANLEEFNADVQMS 2014
              .||.:.   |:|  :...:...:.:| .|.:|....|:|                        
Human    87 --RLRKLP---DSF--FKPPEPKSHSRQASTDAGTAGALTP------------------------ 120

  Fly  2015 ASSMPSGSQGTRRHAFFARSESTLSLGCSAP-----------------------EGFELPLDMAM 2056
                    |..|.|:    |.::|.||..:|                       ..||:|.|:.:
Human   121 --------QHVRAHS----SPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPL 173

  Fly  2057 PLADKPHLLQPNSKRQELFANLPLLVTT------------------------NANN--SGATNDG 2095
            |...:   :...|..|..|.|.....||                        |..|  ||...||
Human   174 PAGWE---MAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDG 235

  Fly  2096 ------DGGSIF---------DYTPTRLGFSNSLKRNERVYETVPID-----SSKTGDGNVTNKA 2140
                  ..|.|:         .:...||........|:|:.::.|:.     :.::..|.|.   
Human   236 WEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFGKAMNQRISQSAPVKQPPPLAPQSPQGGVM--- 297

  Fly  2141 EGSTDSNIYVQLKKKQGSDDFKSHKEADGNQSKYEKVVLMETDDSLPSTSKSTEALMATRPEVII 2205
             |.::||...|::.:|             .|.:.|::.|           |..|.|...||:.: 
Human   298 -GGSNSNQQQQMRLQQ-------------LQMEKERLRL-----------KQQELLRQVRPQAM- 336

  Fly  2206 APNKASVSPATA-ARSVIVLAGGSCLKTIDSD-------------------INNYSASNLSTAEQ 2250
                .:::|:|| :.....||..|.|.|::.|                   ..|.|...|::...
Human   337 ----RNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTY 397

  Fly  2251 AKCDTQYQKSTSDHLLLFPARGSQFYQS----------NFSELPSW-----NFLLSRWKLTLDLF 2300
            ...|.......|......|.....|..|          |.|.|||.     ::|.:.....:|| 
Human   398 HSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDL- 461

  Fly  2301 GRVFMDDVGMEHGSVLPELRGFPVKEMRFRRHMEKLRNGQQRDL--VLCKLERNRESLI 2357
            |.:..|.:.:|...::|.|:             |.|.:....|:  ||...:.::||.:
Human   462 GTLEGDGMNIEGEELMPSLQ-------------EALSSDILNDMESVLAATKLDKESFL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
hydNP_001287262.1 E3_UbLigase_EDD 150..196 CDD:288409
ZnF_UBR1 1217..1284 CDD:197698
ASF1_hist_chap 1535..1733 CDD:304562
PolyA 2498..2561 CDD:197769
HECTc 2589..2885 CDD:238033
HECTc 2589..2884 CDD:214523
YAP1XP_005271435.1 WW 174..203 CDD:238122 7/31 (23%)
WW 232..261 CDD:366073 4/28 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.