DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trbd and otud7a

DIOPT Version :9

Sequence 1:NP_649931.1 Gene:trbd / 41179 FlyBaseID:FBgn0037734 Length:778 Species:Drosophila melanogaster
Sequence 2:XP_004917978.2 Gene:otud7a / 779462 XenbaseID:XB-GENE-1012996 Length:928 Species:Xenopus tropicalis


Alignment Length:468 Identity:126/468 - (26%)
Similarity:186/468 - (39%) Gaps:140/468 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 ISGSQNDLHASSSLNSQEENQQQLQQPNVDTVSVNNSFNKKHIYQLGSSETINNCDTLQERQERR 327
            :.|...||.|:.|      :.:||:|  |.|.::...||:...|:....|...:.:.:::...:|
 Frog    27 LEGKNWDLTAALS------DYEQLRQ--VHTANLPQVFNEGKYYKQQEKEITQHVNKIEKPNLQR 83

  Fly   328 QRQIRRQVDWQWLNACLGVVENNYSAVEAYLSCGGNPARSLTSTEIAALNRNSAFDVGHTLIHLA 392
            |..|                     |.|..||.|.:.|    |:.|.:|.|          :|:|
 Frog    84 QDDI---------------------AQEKRLSRGISHA----SSAIVSLAR----------LHVA 113

  Fly   393 IRFHREEMLPMLLDQISGSGPGIKRVPSYVAPDLAADIRRHFANTLRLRKSGLPCHYVQKHATFA 457
            .....|   |..|:           :|.|                                 ||.
 Frog   114 NECSSE---PFPLE-----------MPIY---------------------------------TFQ 131

  Fly   458 LPAEIEELPIPIQEQLYDELLDRDAQKQ-----LETPPPALNWSLEITARLSSRMFVLWNRSAGD 517
            ||      .:.:..:.:...::||..:|     || ....||| ...|.....|:..|.....|:
 Frog   132 LP------DLSVYSEDFRSFIERDLIEQSTMVALE-QAGRLNW-WSTTCSSCKRLLPLATTGDGN 188

  Fly   518 CLLDSAMQATWGVFDRDNILRRALADTLHQCGHVFFT-----RWKEYEMLQASMLHFTLEDSQFE 577
            |||.:|....||..|||.:||:||. |:.:.|.....     ||::.:..:.|.|.:|  :.::|
 Frog   189 CLLHAASLGMWGFHDRDLVLRKALY-TMMRSGAEREALKRRWRWQQTQQNKESGLVYT--EDEWE 250

  Fly   578 EDWSTLLSLA------------GQPG----------SSLEQLHIFALAHILRRPIIVYGVKYVKS 620
            .:|:.||.||            |..|          .|||:.|:|.|||||||||:|.....::.
 Frog   251 REWNELLKLASSEPRTHFSKNGGSGGGVDNAEDPVYESLEEFHVFVLAHILRRPIVVVADTMLRD 315

  Fly   621 FRGEDIGYARFEGVYLPLFWDQNFCTKSPIALGYTRGHFSALVPMEPFTRIDGRRDDVEDVTYLP 685
            ..||......|.|:||||....|.|..||:.|.|.:.||||||.||       ::|...:...:|
 Frog   316 SGGEAFAPIPFGGIYLPLEVPPNRCHCSPLVLAYDQAHFSALVSME-------QKDQQREQAVIP 373

  Fly   686 LMDCELKLLPIHF 698
            |:|.|.||||:||
 Frog   374 LIDSEHKLLPLHF 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trbdNP_649931.1 zf-RanBP 11..36 CDD:279035
RanBP2-type Zn finger 11..30 CDD:275376
ZnF_RBZ 91..114 CDD:197784
RanBP2-type Zn finger 93..112 CDD:275376
RanBP2-type Zn finger 175..192 CDD:275375
ZnF_RBZ 234..256 CDD:197784
RanBP2-type Zn finger 236..255 CDD:275376
OTU 513..659 CDD:280496 58/172 (34%)
otud7aXP_004917978.2 UBA_Cezanne_like 4..46 CDD:270532 7/24 (29%)
OTU 184..354 CDD:418725 58/172 (34%)
zf-A20 889..912 CDD:396357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D319972at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4304
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.