DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trbd and TNFAIP3

DIOPT Version :9

Sequence 1:NP_649931.1 Gene:trbd / 41179 FlyBaseID:FBgn0037734 Length:778 Species:Drosophila melanogaster
Sequence 2:NP_001257436.1 Gene:TNFAIP3 / 7128 HGNCID:11896 Length:790 Species:Homo sapiens


Alignment Length:340 Identity:96/340 - (28%)
Similarity:156/340 - (45%) Gaps:53/340 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 EEMLPMLLDQISGSGPGIKRVPSYVAPDLAADIRRHFANTLRLRKSGLPCHYVQKHA-TFALPAE 461
            |::||..| .:|.....:|             ||......:....:|:..|:...|. |..:...
Human     3 EQVLPQAL-YLSNMRKAVK-------------IRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRT 53

  Fly   462 IEELPIPIQEQLYDELLDRDAQKQLETPPPALNWSLEITARLSSRMFVLWNRSAGDCLLDSAMQA 526
            .:..| ..:|.::..|:||:.|..||: ...|||..|:     .::..|.....|:||:.:..|.
Human    54 CQFCP-QFREIIHKALIDRNIQATLES-QKKLNWCREV-----RKLVALKTNGDGNCLMHATSQY 111

  Fly   527 TWGVFDRDNILRRALADTLHQCG-HVFFTRW-----KEYEMLQASMLHFTLEDSQFEEDWSTLLS 585
            .|||.|.|.:||:||..||.:.. ..|..||     |..|.::..:.:.|   ..:.::|..|:.
Human   112 MWGVQDTDLVLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDT---RNWNDEWDNLIK 173

  Fly   586 LA---------GQPGSSLEQLHIFALAHILRRPIIVYGVKYVKSFR-GEDIGYARFEGVYLPLFW 640
            :|         |...:|||::|||.|.:||||||||...|.::|.. |.:....:..|:||||.|
Human   174 MASTDTPMARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHW 238

  Fly   641 DQNFCTKSPIALGYTRGHFSALVPMEPFTRIDGRRDDVEDVTYLPLMDCE---LKLLPIHFLTQS 702
            ....|.:.||.|||...||..||.:         :|...::..:||::.:   .:.|.:||||..
Human   239 PAQECYRYPIVLGYDSHHFVPLVTL---------KDSGPEIRAVPLVNRDRGRFEDLKVHFLTDP 294

  Fly   703 EVGNEESMMRQWLDV 717
            |...:|.:::::|.|
Human   295 ENEMKEKLLKEYLMV 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trbdNP_649931.1 zf-RanBP 11..36 CDD:279035
RanBP2-type Zn finger 11..30 CDD:275376
ZnF_RBZ 91..114 CDD:197784
RanBP2-type Zn finger 93..112 CDD:275376
RanBP2-type Zn finger 175..192 CDD:275375
ZnF_RBZ 234..256 CDD:197784
RanBP2-type Zn finger 236..255 CDD:275376
OTU 513..659 CDD:280496 55/161 (34%)
TNFAIP3NP_001257436.1 TRAF-binding 58..300 81/260 (31%)
OTU 98..257 CDD:280496 55/161 (34%)
Interaction with ubiquitin. /evidence=ECO:0000305 157..159 0/1 (0%)
Interaction with ubiquitin. /evidence=ECO:0000305 190..192 1/1 (100%)
Interaction with ubiquitin. /evidence=ECO:0000305 224..227 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..377
Interaction with TNIP1. /evidence=ECO:0000250 369..775
ZnF_A20 384..409 CDD:128555
Interaction with RIPK1. /evidence=ECO:0000269|PubMed:19131965 386..453
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..434
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 447..468
ZnF_A20 475..500 CDD:128555
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 550..583
ZnF_A20 604..629 CDD:128555
Required for proteosomal degradation of UBE2N and UBE2D3, TRAF6 deubiquitination, and TAX1BP1 interaction with UBE2N. /evidence=ECO:0000250 605..655
Sufficient for inhibitory activity of TNF-induced NF-kappa-B activity. /evidence=ECO:0000250 606..790
ZnF_A20 654..679 CDD:128555
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 689..712
Required for lysosomal localization and for TRAF2 lysosomal degradation 697..790
ZnF_A20 713..738 CDD:128555
ZnF_A20 759..784 CDD:128555
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D319972at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13367
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.