DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trbd and Otud7b

DIOPT Version :9

Sequence 1:NP_649931.1 Gene:trbd / 41179 FlyBaseID:FBgn0037734 Length:778 Species:Drosophila melanogaster
Sequence 2:NP_001101167.1 Gene:Otud7b / 310677 RGDID:1308111 Length:841 Species:Rattus norvegicus


Alignment Length:366 Identity:103/366 - (28%)
Similarity:168/366 - (45%) Gaps:82/366 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 ELP-IPIQEQLYDELLDRDAQKQ-----LETPPPALNW--SLEITARLSSRMFVLWNRSAGDCLL 520
            :|| :.:.::.:...::||..:|     || ....|||  |::.|.:   |:..|.....|:|||
  Rat   136 QLPDLTVYKEDFRSFIERDLIEQSMLVALE-QAGRLNWWVSVDSTCQ---RLLPLATTGDGNCLL 196

  Fly   521 DSAMQATWGVFDRDNILRRAL---------ADTLHQCGHVFFTRWKEYEMLQASMLHFTLEDSQF 576
            .:|....||..|||.:||:||         .:.|.:     ..||::.:..:.|.|.:|  :.::
  Rat   197 HAASLGMWGFHDRDLVLRKALYALMEKGVEKEALKR-----RWRWQQTQQNKESGLVYT--EDEW 254

  Fly   577 EEDWSTLLSLA-----------GQPG-----------SSLEQLHIFALAHILRRPIIVYGVKYVK 619
            :::|:.|:.||           |..|           .|||:.|:|.|||:|:|||:|.....::
  Rat   255 QKEWNELIKLASSEPRMHLGTNGASGGGVESSEEPVYESLEEFHVFVLAHVLKRPIVVVADTMLR 319

  Fly   620 SFRGEDIGYARFEGVYLPLFWDQNFCTKSPIALGYTRGHFSALVPMEPFTRIDGRRDDVEDVTYL 684
            ...||......|.|:||||....:.|.:||:.|.|.:.||||||.||       ::|..::...:
  Rat   320 DSGGEAFAPIPFGGIYLPLEVPASQCHRSPLVLAYDQAHFSALVSME-------QKDSAKEQAVI 377

  Fly   685 PLMDCELKLLPIHFLTQS----EVGNEESMMRQWLDVCVTDGGLLVAQQKLSKRPLLVAQMLEEW 745
            ||.|.|.||||:||....    |.|.:::...:...|      :|..:.||.   ||.:.|..:|
  Rat   378 PLTDSEHKLLPLHFAVDPGKGWEWGKDDNDNVRLASV------ILSLEVKLH---LLHSYMNVKW 433

  Fly   746 LNHYRRIAQVITAPFIRRPQITHYSSD--------GDSDEE 778
            :    .::....||..:....|..:.|        |:||:|
  Rat   434 I----PLSSESQAPLAQPESPTASAGDEPRSTPESGESDKE 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trbdNP_649931.1 zf-RanBP 11..36 CDD:279035
RanBP2-type Zn finger 11..30 CDD:275376
ZnF_RBZ 91..114 CDD:197784
RanBP2-type Zn finger 93..112 CDD:275376
RanBP2-type Zn finger 175..192 CDD:275375
ZnF_RBZ 234..256 CDD:197784
RanBP2-type Zn finger 236..255 CDD:275376
OTU 513..659 CDD:280496 52/176 (30%)
Otud7bNP_001101167.1 UBA_Cezanne_like 4..46 CDD:270532
OTU 189..359 CDD:303090 52/176 (30%)
zf-A20 799..821 CDD:280010
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D319972at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.