DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trbd and OTUD7A

DIOPT Version :9

Sequence 1:NP_649931.1 Gene:trbd / 41179 FlyBaseID:FBgn0037734 Length:778 Species:Drosophila melanogaster
Sequence 2:NP_001369566.1 Gene:OTUD7A / 161725 HGNCID:20718 Length:933 Species:Homo sapiens


Alignment Length:548 Identity:143/548 - (26%)
Similarity:215/548 - (39%) Gaps:159/548 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 ISGSQNDLHASSSLNSQEENQQQLQQPNVDTVSVNNSFNKKHIYQLGSSETINNCDTLQERQERR 327
            :.|...||.|:.|      :.:||:|  |.|.      |..|::..|..          .:|..|
Human    49 LEGKNWDLTAALS------DYEQLRQ--VHTA------NLPHVFNEGRG----------PKQPER 89

  Fly   328 QRQIRRQVDWQWLNACLGVVENNYSAVEAYLSCGGNPARSLTSTEIAALNRNSAFDVGHTLIHLA 392
            :.|...:|:    ..||  ...:..|.|..||.|.:.|    |:.|.:|.|:          |:|
Human    90 EPQPGHKVE----RPCL--QRQDDIAQEKRLSRGISHA----SSAIVSLARS----------HVA 134

  Fly   393 IRFHREEMLPMLLDQISGSGPGIKRVPSYVAPDLAADIRRHFANTLRLRKSGLPCHYVQKHATFA 457
            ...:.|: .|:             .:|.|                                 ||.
Human   135 SECNNEQ-FPL-------------EMPIY---------------------------------TFQ 152

  Fly   458 LPAEIEELPIPIQEQLYDELLDRDAQKQ-----LETPPPALNWSLEITARLSSRMFVLWNRSAGD 517
            ||      .:.:..:.:...::||..:|     ||.......||...|:  ..|:..|.....|:
Human   153 LP------DLSVYSEDFRSFIERDLIEQATMVALEQAGRLNWWSTVCTS--CKRLLPLATTGDGN 209

  Fly   518 CLLDSAMQATWGVFDRDNILRRALADTLHQCGHVFFT-----RWKEYEMLQASMLHFTLEDSQFE 577
            |||.:|....||..|||.:||:||. |:.:.|.....     ||::.:..:.|.|.:|  :.::|
Human   210 CLLHAASLGMWGFHDRDLVLRKALY-TMMRTGAEREALKRRWRWQQTQQNKESGLVYT--EEEWE 271

  Fly   578 EDWSTLLSLA------------GQPG----------SSLEQLHIFALAHILRRPIIVYGVKYVKS 620
            .:|:.||.||            |..|          .|||:.|:|.|||||||||:|.....::.
Human   272 REWTELLKLASSEPRTHFSKNGGTGGGVDNSEDPVYESLEEFHVFVLAHILRRPIVVVADTMLRD 336

  Fly   621 FRGEDIGYARFEGVYLPLFWDQNFCTKSPIALGYTRGHFSALVPMEPFTRIDGRRDDVEDVTYLP 685
            ..||......|.|:||||....|.|..||:.|.|.:.||||||.||       :||...:...:|
Human   337 SGGEAFAPIPFGGIYLPLEVPPNRCHCSPLVLAYDQAHFSALVSME-------QRDQQREQAVIP 394

  Fly   686 LMDCELKLLPIHFLTQS----EVGNEESMMRQWLDVCVTDGGLLVAQQKLSKRPLLVAQMLEEWL 746
            |.|.|.||||:||....    |.|.:::...:...:      :|..:.||:   ||.:.|...|:
Human   395 LTDSEHKLLPLHFAVDPGKDWEWGKDDNDNARLAHL------ILSLEAKLN---LLHSYMNVTWI 450

  Fly   747 NHYRRIAQVITAPFIRRPQITHYSSDGD 774
                ||.....|| :.:|:....|:..|
Human   451 ----RIPSETRAP-LAQPESPTASAGED 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trbdNP_649931.1 zf-RanBP 11..36 CDD:279035
RanBP2-type Zn finger 11..30 CDD:275376
ZnF_RBZ 91..114 CDD:197784
RanBP2-type Zn finger 93..112 CDD:275376
RanBP2-type Zn finger 175..192 CDD:275375
ZnF_RBZ 234..256 CDD:197784
RanBP2-type Zn finger 236..255 CDD:275376
OTU 513..659 CDD:280496 58/172 (34%)
OTUD7ANP_001369566.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..99 6/37 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 459..521 4/16 (25%)
Nuclear localization signal. /evidence=ECO:0000255 501..516
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 544..620
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 675..775
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4345
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D319972at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4304
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.