DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Unc-115b and Dmtn

DIOPT Version :9

Sequence 1:NP_731390.1 Gene:Unc-115b / 41178 FlyBaseID:FBgn0260463 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001381675.1 Gene:Dmtn / 361069 RGDID:1311419 Length:405 Species:Rattus norvegicus


Alignment Length:321 Identity:73/321 - (22%)
Similarity:115/321 - (35%) Gaps:113/321 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 TPLS--PHFHRPSSYATTASNAGSVAGSRPPSRPHSRTRSAMKVLVDAIRSETPRPKSPGMNNEE 496
            ||.:  ||||.|.:             :||.|..:.:     ..:.....|....|:|..:..:.
  Rat   120 TPRTSLPHFHHPET-------------TRPDSNIYKK-----PPIYKQRESVGGSPQSKHLIEDL 166

  Fly   497 PIELSHYPAAKKPPPGEQPKIERDDFPAPP-YPYTDPERRRRYSDTYKGVPASDDEDENVENGKP 560
            .||.|.:|||:.|.|.:..|||.|.:|.|| ....:.|.|:|.: :.||....::|:::      
  Rat   167 IIESSKFPAAQPPDPNQPAKIETDYWPCPPSLAVVETEWRKRKA-SRKGAEEEEEEEDD------ 224

  Fly   561 NGKVKNGEEQQRL--QREAEQLEKLNSGIGSAIAKDLKEHAKYRKWKQNNLDPRNASRTPSASKE 623
                 :.||:.:.  :|:.|:|.|:.|.:|..|.|:..|.:                 .|...| 
  Rat   225 -----DSEEEIKAIRERQKEELSKVTSNLGKMILKEEMEKS-----------------LPIRRK- 266

  Fly   624 PLYKLRYESPIGASPSRNLDHQKPFYEDEMFDRSTSYRGSLGKSLGNAPSYNAIHSYRSPPKPGY 688
                           :|:|..:.||:        ||......|| .:.|||.             
  Rat   267 ---------------TRSLPDRTPFH--------TSLHSGTSKS-SSLPSYG------------- 294

  Fly   689 GFKTTTLPYIRNGFSSDFSYGGLGDKTHSTDLSCGKSEASVDSITEGD-RRALM--GGDLP 746
               .|||                 .:..||:.|...|||....:..|: :|..|  |..||
  Rat   295 ---RTTL-----------------SRLQSTEFSPSGSEAGSPGLQNGEGQRGRMDRGNSLP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Unc-115bNP_731390.1 LIM1_abLIM 46..97 CDD:188713
LIM2_abLIM 102..157 CDD:188714
LIM3_abLIM 211..262 CDD:188715
LIM4_abLIM 270..326 CDD:188716
DmtnNP_001381675.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354107
Domainoid 1 1.000 66 1.000 Domainoid score I9669
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24213
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.