DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Unc-115b and DMTN

DIOPT Version :9

Sequence 1:NP_731390.1 Gene:Unc-115b / 41178 FlyBaseID:FBgn0260463 Length:784 Species:Drosophila melanogaster
Sequence 2:NP_001107607.1 Gene:DMTN / 2039 HGNCID:3382 Length:405 Species:Homo sapiens


Alignment Length:467 Identity:104/467 - (22%)
Similarity:155/467 - (33%) Gaps:179/467 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 PRCGPG---PSESGIILNGGGGTSSVVGGASN-----------------------------GNFT 352
            |...||   ||....:   .|..||:|....|                             .:||
Human     8 PLTSPGSVSPSRDSSV---PGSPSSIVAKMDNQVLGYKDLAAIPKDKAILDIERPDLMIYEPHFT 69

  Fly   353 -----DTECDRMSSSALSEMYIRSRTPSFNGSLYSSSRKHYRTVSPGLILREYGRPNAEDISRIY 412
                 ..|..|....:||.   :|.:|..:..:::.||      |||:|.:              
Human    70 YSLLEHVELPRSRERSLSP---KSTSPPPSPEVWADSR------SPGIISQ-------------- 111

  Fly   413 TYSYLTDAPHYLRKPIDPYDKTPLSPHFHRPSSYATTASNAGSVAGSRPPSRPHSRTRSAMKVLV 477
                 ..||.....|     :|.| ||||.|.:             |||.|..:.:     ..:.
Human   112 -----ASAPRTTGTP-----RTSL-PHFHHPET-------------SRPDSNIYKK-----PPIY 147

  Fly   478 DAIRSETPRPKSPGMNNEEPIELSHYPAAKKPPPGEQPKIERDDFPAPP-YPYTDPERRRRYSDT 541
            ....|....|::..:..:..||.|.:|||:.|.|.:..|||.|.:|.|| ....:.|.|:|.:..
Human   148 KQRESVGGSPQTKHLIEDLIIESSKFPAAQPPDPNQPAKIETDYWPCPPSLAVVETEWRKRKASR 212

  Fly   542 YKGVPASDDEDENVENGKPNGKVKNGEEQQRL-QREAEQLEKLNSGIGSAIAKDLKEHAKYRKWK 605
            .......::||::           :|||.:.| :|:.|:|.|:.|.:|..|.|:..|.:      
Human   213 RGAEEEEEEEDDD-----------SGEEMKALRERQREELSKVTSNLGKMILKEEMEKS------ 260

  Fly   606 QNNLDPRNASRTPSASKEPLYKLRYESPIGASPSRNLDHQKPFYEDEMFDRSTSYRGSLGKSLGN 670
                       .|...|                :|:|..:.||:..  ..:.||...||      
Human   261 -----------LPIRRK----------------TRSLPDRTPFHTS--LHQGTSKSSSL------ 290

  Fly   671 APSYNAIHSYRSPPKPGYGFKTTTLPYIRNGFSSDFSYGGLGDKTHSTDLSCGKSEASVDSITEG 735
                           |.||  .|||..::   |::||..  |.:|.|..|..|          ||
Human   291 ---------------PAYG--RTTLSRLQ---STEFSPS--GSETGSPGLQNG----------EG 323

  Fly   736 DR-RALMGGDLP 746
            .| |...|..||
Human   324 QRGRMDRGNSLP 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Unc-115bNP_731390.1 LIM1_abLIM 46..97 CDD:188713
LIM2_abLIM 102..157 CDD:188714
LIM3_abLIM 211..262 CDD:188715
LIM4_abLIM 270..326 CDD:188716 3/8 (38%)
DMTNNP_001107607.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 7/24 (29%)
AbLIM_anchor 8..369 CDD:406566 104/467 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..158 26/130 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..192 9/18 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..332 46/212 (22%)
Interaction with RASGRF2. /evidence=ECO:0000269|PubMed:11856323 224..308 31/155 (20%)
VHP 370..405 CDD:128458
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160039
Domainoid 1 1.000 89 1.000 Domainoid score I7842
eggNOG 1 0.900 - - E1_KOG1044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24213
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.