DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and ERP5

DIOPT Version :9

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_011978.1 Gene:ERP5 / 856510 SGDID:S000001152 Length:212 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:64/214 - (29%)
Similarity:117/214 - (54%) Gaps:15/214 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALILCVLHSACGLYFHISETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEV 72
            :.|:..:..:...::|:....|.|||.|.:.....:|.:  ::|| ...:|.....|...:.:.|
Yeast     9 ICLLFAITQAVGAVHFYAKSGETKCFYEHLSRGNLLIGD--LDLY-VEKDGLFEEDPESSLTITV 70

  Fly    73 RDS--DDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFS--GAQLRVHLDIQVGE-HAID 132
            .::  :|..||::..|..|.::||:...|||..|.    |.::|  .|.|||.:::::|. .|:|
Yeast    71 DETFDNDHRVLNQKNSHTGDVTFTALDTGEHRFCF----TPFYSKKSATLRVFIELEIGNVEALD 131

  Fly   133 YAHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVC 197
               ..:||.:..|:.|:.||..::..|.|||:..|.:|..||:.|||.||:::.||:.|.::|:.
Yeast   132 ---SKKKEDMNSLKGRVGQLTQRLSSIRKEQDAIREKEAEFRNQSESANSKIMTWSVFQLLILLG 193

  Fly   198 MGFWQMRHLKSFFEAKKLV 216
            ...:|:|:||:||..:|:|
Yeast   194 TCAFQLRYLKNFFVKQKVV 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 60/195 (31%)
ERP5NP_011978.1 EMP24_GP25L 21..206 CDD:395878 59/194 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I1373
eggNOG 1 0.900 - - E1_KOG1690
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I1337
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoFinder 1 1.000 - - FOG0001070
OrthoInspector 1 1.000 - - mtm9154
orthoMCL 1 0.900 - - OOG6_102210
Panther 1 1.100 - - LDO PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.