DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and ERV25

DIOPT Version :9

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_013701.1 Gene:ERV25 / 854997 SGDID:S000004473 Length:211 Species:Saccharomyces cerevisiae


Alignment Length:217 Identity:64/217 - (29%)
Similarity:117/217 - (53%) Gaps:21/217 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALILCVLHSACGLYFHI---SETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIG-- 67
            |..::.::.:..||:|.|   ::.|:.|..:.|.:...|:.       |..|:|    |.|.|  
Yeast     8 LTTLISLVVAVQGLHFDIAASTDPEQVCIRDFVTEGQLVVA-------DIHSDG----SVGDGQK 61

  Fly    68 MHVEVRDS-DDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQL--RVHLDIQVGEH 129
            :::.|||| .::....|.::...|::||:.:.....:| |.|. |.:.|..|  .:.|||:.|..
Yeast    62 LNLFVRDSVGNEYRRKRDFAGDVRVAFTAPSSTAFDVC-FENQ-AQYRGRSLSRAIELDIESGAE 124

  Fly   130 AIDYAHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVV 194
            |.|:..::..|||..:::.:|::.:..::|..|..|.:.||||.|.|:||||.||..:|:...:|
Yeast   125 ARDWNKISANEKLKPIEVELRRVEEITDEIVDELTYLKNREERLRDTNESTNRRVRNFSILVIIV 189

  Fly   195 LVCMGFWQMRHLKSFFEAKKLV 216
            |..:|.||:.:||::|:.|.::
Yeast   190 LSSLGVWQVNYLKNYFKTKHII 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 61/198 (31%)
ERV25NP_013701.1 EMP24_GP25L 20..206 CDD:395878 61/198 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.