DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and Tmed10

DIOPT Version :9

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_445919.1 Gene:Tmed10 / 84599 RGDID:620970 Length:219 Species:Rattus norvegicus


Alignment Length:213 Identity:70/213 - (32%)
Similarity:117/213 - (54%) Gaps:11/213 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ISLALILCVL--HSACGLYFHISETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGM 68
            :|..|.|.:|  .|..|:.||:....|||..||:..:..|...|::   ..:|.|    :.|:..
  Rat    15 LSALLFLFLLGPSSVLGISFHLPVNSRKCLREEIHKDLLVTGAYEI---TDQSGG----AGGLRT 72

  Fly    69 HVEVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLRVHLDIQVGEHAIDY 133
            |:::.||...|:.::..:::|:.:||:.......:|..|..|..... || |.||::.|..|.:|
  Rat    73 HLKITDSAGHILYAKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPD-QL-VILDMKHGVEAKNY 135

  Fly   134 AHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCM 198
            ..:|:.|||..|::.:|:|.|..|.|..:..|.:.|||..|.|:||||:|||::|:.....|:.:
  Rat   136 EEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGL 200

  Fly   199 GFWQMRHLKSFFEAKKLV 216
            ..||:.:|:.||:||||:
  Rat   201 ATWQVFYLRRFFKAKKLI 218

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 60/190 (32%)
Tmed10NP_445919.1 Required for interaction with STX17. /evidence=ECO:0000250 1..142 37/135 (27%)
EMP24_GP25L 31..213 CDD:395878 60/190 (32%)
Required for TMED10 and TMED2 cis-Golgi network localization. /evidence=ECO:0000250 147..178 11/30 (37%)
Interaction with COPG1. /evidence=ECO:0000250 204..219 8/15 (53%)
Interaction with ARF1 and IL1B. /evidence=ECO:0000250|UniProtKB:P49755 207..219 7/12 (58%)
COPI vesicle coat-binding. /evidence=ECO:0000255 211..219 6/8 (75%)