DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and AT1G26690

DIOPT Version :9

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_564256.1 Gene:AT1G26690 / 839210 AraportID:AT1G26690 Length:214 Species:Arabidopsis thaliana


Alignment Length:229 Identity:56/229 - (24%)
Similarity:101/229 - (44%) Gaps:38/229 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ISLALILCVL----HSACGLYFHISETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGI 66
            ::|..||..|    ..:..|:|.:.....||..|::...:..:..|.|  .:|......|.|..|
plant     6 LNLCTILLFLAISSQVSQSLHFELQSGRTKCISEDIKSNSMTVGKYTV--VNPNEAHPSPQSHKI 68

  Fly    67 GMHVEVRDSDDKIVLSRVYSS------------QGRISFTSHTPGEHVICMFSNSTAWFSGAQLR 119
            .:              ||.||            .|:.:||:...|:::.|.  .:........|.
plant    69 SI--------------RVTSSYGNTYHHAEDVESGQFAFTAVESGDYMACY--TAVDHKPEVTLS 117

  Fly   120 VHLDIQVGEHAIDYAHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRV 184
            :..|.:.|..:..::.||:|.::..::..:::|::.|..|.:|..|.|.|||..::.:.:|||::
plant   118 IDFDWRTGVQSKSWSSVAKKSQVEVMEFDVKRLIETVNSIHEEMFYLREREEEMQNLNRATNSKM 182

  Fly   185 LWWSLAQTVVLVCMGF--WQMRHLKSFFEAKKLV 216
            .|.|...  :.||:|.  .|..|||:|||.||::
plant   183 AWLSFLS--LFVCLGVAGMQFVHLKTFFEKKKVI 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 48/204 (24%)
AT1G26690NP_564256.1 EMP24_GP25L 24..209 CDD:279450 48/204 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1093
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22811
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.