DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and AT2G03290

DIOPT Version :9

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_178428.3 Gene:AT2G03290 / 814858 AraportID:AT2G03290 Length:213 Species:Arabidopsis thaliana


Alignment Length:223 Identity:60/223 - (26%)
Similarity:106/223 - (47%) Gaps:29/223 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLALILCVLHS--ACGLYFHISETERKCFIEEVPDETTVIVNYKVELYDP-RSNGFMPSS----- 63
            |:.|::..|.|  ...:.:.:..::.||..||:.:....|..|.:  .:| ..|..:|.|     
plant     7 SILLLIIALLSPRTLSMRYELKSSKTKCIGEEIHENAMSIGKYFI--VNPNEDNHPLPDSHKIIV 69

  Fly    64 -----PGIGMHVEVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLRVHLD 123
                 .|..:|     ..||:       ..|:.|||::..|.:|.|:  .:..:.....|.:..|
plant    70 KVMPPQGKNLH-----EADKV-------EAGQFSFTAYENGSYVACI--TAIDYKPETTLTIDFD 120

  Fly   124 IQVGEHAIDYAHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWS 188
            .:.|.|:.::.:||:|.::..::.:::.|:|.|..|.:|..|.|.|||..:..:.||||::.|.|
plant   121 WKTGVHSKEWTNVAKKSQVDMMEYQVKTLMDTVISIHEEMYYLREREEEMQELNRSTNSKMAWLS 185

  Fly   189 LAQTVVLVCMGFWQMRHLKSFFEAKKLV 216
            ....||.:.:...|..|||:|||.|||:
plant   186 FGSLVVCLSVAGLQFWHLKTFFEKKKLI 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 51/201 (25%)
AT2G03290NP_178428.3 EMP24_GP25L 22..208 CDD:366467 51/201 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 1 1.010 - - D1294924at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1093
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.