DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and Tmed11

DIOPT Version :9

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_001071744.1 Gene:Tmed11 / 689712 RGDID:1588776 Length:214 Species:Rattus norvegicus


Alignment Length:210 Identity:101/210 - (48%)
Similarity:148/210 - (70%) Gaps:4/210 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILCVLHS-ACGLYFHISETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEVR 73
            ::||...| :...|||..|.|.||.||::|.:|.:...:|::.:|...:.|:.|:||:||.|.|.
  Rat     6 ILLCFSFSFSAAFYFHAGEREEKCIIEDIPSDTLITGTFKIQQWDIGRHDFLESAPGLGMFVTVT 70

  Fly    74 DSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAW--FSGAQLRVHLDIQVGEHAIDYAHV 136
            ::|: ::||::|.:||...||||:.|||:||:.||||.:  |.|::||:||||:||||.:|...|
  Rat    71 NNDE-VLLSKLYGAQGTFYFTSHSSGEHIICLESNSTQFVSFGGSKLRIHLDIRVGEHDLDAVIV 134

  Fly   137 AQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGFW 201
            ..|:|:.|:...:|.|::|:|||.|||:|||.|||.||.|||.||..||||:.||.::.:.:|.:
  Rat   135 QAKDKVNEVAFTLRHLIEQIEQILKEQDYQRDREENFRITSEDTNRNVLWWAFAQILIFISVGIF 199

  Fly   202 QMRHLKSFFEAKKLV 216
            ||:|||.||.|||||
  Rat   200 QMKHLKDFFIAKKLV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 92/192 (48%)
Tmed11XP_001071744.1 EMP24_GP25L 17..208 CDD:395878 91/191 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1690
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 1 1.010 - - D1294924at2759
OrthoFinder 1 1.000 - - FOG0001070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X178
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.790

Return to query results.
Submit another query.