DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and Tmed3

DIOPT Version :10

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_079636.2 Gene:Tmed3 / 66111 MGIID:1913361 Length:221 Species:Mus musculus


Alignment Length:228 Identity:61/228 - (26%)
Similarity:103/228 - (45%) Gaps:39/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QFISLALILCVLHS----ACGLYFHISETERKCFIEEVPD------ETTVIV--NYKVELY--DP 54
            |.:...|:|.:|.:    :..|.|.:.:..::||.|||..      :..||.  :|.|:.|  ||
Mouse    12 QMLLQLLLLLLLRAEPLRSAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVEDP 76

  Fly    55 RSNGFMPSSPGIGMHVEVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLR 119
            |.|            |..|::      .:.|.|   .::.:...|.:..| |||..:.||  ...
Mouse    77 RGN------------VIYRET------KKQYDS---FTYKTEAKGVYRFC-FSNEFSTFS--HKT 117

  Fly   120 VHLDIQVGEHAIDYAHVAQK-EKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSR 183
            |:.|.|||:.......:..: ..||:::.....:.:.::.:...|.:.|.||.:.|..:|..|||
Mouse   118 VYFDFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSR 182

  Fly   184 VLWWSLAQTVVLVCMGFWQMRHLKSFFEAKKLV 216
            |.:||:.:|:.|..:.|.|:..|||||..|:.|
Mouse   183 VSYWSVGETIALFVVSFSQVLLLKSFFTEKRPV 215

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:426051 54/201 (27%)
Tmed3NP_079636.2 EMP24_GP25L 32..209 CDD:426051 53/200 (27%)
COPI vesicle coat-binding. /evidence=ECO:0000255 208..221 4/8 (50%)