DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and tmed4

DIOPT Version :9

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001002134.1 Gene:tmed4 / 415224 ZFINID:ZDB-GENE-040625-140 Length:220 Species:Danio rerio


Alignment Length:217 Identity:144/217 - (66%)
Similarity:173/217 - (79%) Gaps:10/217 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILCV--------LHSACGLYFHISETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGI 66
            |:.||        |..:..|||||.|||:||||||:||||.||..|:.:|:|.::..|:||:||:
Zfish     4 LVSCVGFLLLFVWLSPSQALYFHIGETEKKCFIEEIPDETMVIGRYRTQLWDKQAGSFLPSTPGL 68

  Fly    67 GMHVEVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNST--AWFSGAQLRVHLDIQVGEH 129
            |||||::|.:.|::|||.|.|.||.:|||||||||.||:.||||  |.|:|.:||||||||||||
Zfish    69 GMHVEIKDPETKVILSRQYGSDGRFTFTSHTPGEHQICLHSNSTKMALFAGGKLRVHLDIQVGEH 133

  Fly   130 AIDYAHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVV 194
            ..:|..:|.|:||||||||:||||||||||.||||||||||||||.||||||.||||||:||||:
Zfish   134 TNNYPEIAAKDKLTELQLRVRQLLDQVEQIQKEQNYQRYREERFRMTSESTNQRVLWWSIAQTVI 198

  Fly   195 LVCMGFWQMRHLKSFFEAKKLV 216
            |:..|.|||:||||||||||||
Zfish   199 LIITGIWQMKHLKSFFEAKKLV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 133/192 (69%)
tmed4NP_001002134.1 EMP24_GP25L 22..215 CDD:279450 133/192 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574549
Domainoid 1 1.000 291 1.000 Domainoid score I1497
eggNOG 1 0.900 - - E1_KOG1690
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5308
Inparanoid 1 1.050 301 1.000 Inparanoid score I2657
OMA 1 1.010 - - QHG53581
OrthoDB 1 1.010 - - D1294924at2759
OrthoFinder 1 1.000 - - FOG0001070
OrthoInspector 1 1.000 - - mtm6359
orthoMCL 1 0.900 - - OOG6_102210
Panther 1 1.100 - - LDO PTHR22811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1717
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.