DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and Tmed9

DIOPT Version :9

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001009703.1 Gene:Tmed9 / 361207 RGDID:1307627 Length:235 Species:Rattus norvegicus


Alignment Length:209 Identity:141/209 - (67%)
Similarity:173/209 - (82%) Gaps:2/209 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILCVLHSACGLYFHISETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEVRD 74
            |:||:......|||||.|||:||||||:||||.||.||:.:|||.:...:.|::||:||.|||:|
  Rat    27 LLLCLAARGGALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKD 91

  Fly    75 SDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAW--FSGAQLRVHLDIQVGEHAIDYAHVA 137
            .:||::|:|.|.|:||.:|||||||||.||:.||||.:  |:|..|||||||||||||.|||.:|
  Rat    92 PEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIA 156

  Fly   138 QKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGFWQ 202
            .|:||:|||||:|||::|||||.|||||||:||||||.||||||.||||||:.||::||.:|.||
  Rat   157 AKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQ 221

  Fly   203 MRHLKSFFEAKKLV 216
            ||||||||||||||
  Rat   222 MRHLKSFFEAKKLV 235

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 131/192 (68%)
Tmed9NP_001009703.1 EMP24_GP25L 37..230 CDD:395878 131/192 (68%)
Required for interaction with STX17. /evidence=ECO:0000250 121..160 25/38 (66%)
COPI vesicle coat-binding. /evidence=ECO:0000255 228..235 6/6 (100%)