DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and p24-1

DIOPT Version :9

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001259465.1 Gene:p24-1 / 32140 FlyBaseID:FBgn0030341 Length:210 Species:Drosophila melanogaster


Alignment Length:222 Identity:56/222 - (25%)
Similarity:102/222 - (45%) Gaps:29/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRDQFISLALILCVLH--SACGLYFHISETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSS 63
            |..|.:..|:.| ::|  ||....|.:::....||.||:...::....::|            |:
  Fly     1 MNTQIVVFAVAL-MMHCISAVEFTFDLADNAVDCFYEEIKKNSSAYFEFQV------------SA 52

  Fly    64 PG-IGMHVEVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLRVHLDIQVG 127
            .| :.:.|.::|...|::.|...::.....|.:.|.|.:..| |.|..:.||  ...|::|.|||
  Fly    53 GGQLDVDVTLKDPQGKVIYSLEKATFDSHQFVAETTGVYTAC-FGNQFSAFS--HKIVYVDFQVG 114

  Fly   128 EHAI-----DYAHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWW 187
            |...     ::|.|     ||:::...:.:...:..|...|.:.|.||.:.|..:|..|.||:.|
  Fly   115 EEPALPGVDEHATV-----LTQMETSSQAIHKGLNDILDAQTHHRLREAQGRKRAEDLNQRVMVW 174

  Fly   188 SLAQTVVLVCMGFWQMRHLKSFFEAKK 214
            |..:|..::.:|..|:..|::||..:|
  Fly   175 SSLETAAVIVIGLVQIMVLRNFFTDRK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 47/196 (24%)
p24-1NP_001259465.1 EMP24_GP25L 21..197 CDD:279450 46/195 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454826
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.