DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and CHOp24

DIOPT Version :9

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001284862.1 Gene:CHOp24 / 31382 FlyBaseID:FBgn0029709 Length:208 Species:Drosophila melanogaster


Alignment Length:209 Identity:57/209 - (27%)
Similarity:98/209 - (46%) Gaps:18/209 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILCVLHSACGLYFHISETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEVRD 74
            ||||  .::......:.....:||.|.|...|...|.::|     ...||      :.:.:::..
  Fly    16 LILC--RTSHAFIVSVDAHNEECFFENVEGGTKFGVTFEV-----IDGGF------LDVDIKISG 67

  Fly    75 SDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLRVHLDIQVGEHAIDYAHVAQK 139
            .|:.::......|.|:.:|.:...|.:.:| |:|..:  |.....|...|.||:..........:
  Fly    68 PDNHVMHESEKESSGKYTFVAPAKGTYTVC-FNNERS--SMTPKLVMFSIDVGDAPQRAPGAPGE 129

  Fly   140 EKL--TELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGFWQ 202
            |::  |:|:..||:|...:..:..||.|...|::..|..:|:|||||:.||..:.:|||.|...|
  Fly   130 EEVGHTKLEDMIRELSGTLTSVKHEQEYMHVRDKIHRSVNENTNSRVVLWSTFEALVLVLMTVGQ 194

  Fly   203 MRHLKSFFEAKKLV 216
            :.:||.|||.|::|
  Fly   195 VYYLKRFFEVKRVV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 49/192 (26%)
CHOp24NP_001284862.1 EMP24_GP25L 24..203 CDD:279450 49/192 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454816
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.