DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and C26C6.9

DIOPT Version :9

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001021011.1 Gene:C26C6.9 / 259317 WormBaseID:WBGene00007743 Length:217 Species:Caenorhabditis elegans


Alignment Length:90 Identity:23/90 - (25%)
Similarity:33/90 - (36%) Gaps:41/90 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEVRDSDDKIVLSRVYSSQGR 90
            ||::..|:.|  |.||.:|:|                   |||         :.....||..|.|
 Worm    38 SESQLSCYYE--PLETGMILN-------------------IGM---------RPTFDTVYPMQFR 72

  Fly    91 ISFTSHTPGEHVICMFSNSTAWFSG 115
            ::..|   |:     ||:   |.||
 Worm    73 VTSPS---GD-----FSD---WASG 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 23/90 (26%)
C26C6.9NP_001021011.1 EMP24_GP25L 34..209 CDD:366467 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.