powered by:
Protein Alignment eca and C26C6.9
DIOPT Version :9
Sequence 1: | NP_788616.1 |
Gene: | eca / 41177 |
FlyBaseID: | FBgn0069242 |
Length: | 216 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001021011.1 |
Gene: | C26C6.9 / 259317 |
WormBaseID: | WBGene00007743 |
Length: | 217 |
Species: | Caenorhabditis elegans |
Alignment Length: | 90 |
Identity: | 23/90 - (25%) |
Similarity: | 33/90 - (36%) |
Gaps: | 41/90 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 SETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEVRDSDDKIVLSRVYSSQGR 90
||::..|:.| |.||.:|:| ||| :.....||..|.|
Worm 38 SESQLSCYYE--PLETGMILN-------------------IGM---------RPTFDTVYPMQFR 72
Fly 91 ISFTSHTPGEHVICMFSNSTAWFSG 115
::..| |: ||: |.||
Worm 73 VTSPS---GD-----FSD---WASG 86
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22811 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.