DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and erv25

DIOPT Version :9

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_593403.1 Gene:erv25 / 2541782 PomBaseID:SPAC23H4.03c Length:216 Species:Schizosaccharomyces pombe


Alignment Length:221 Identity:64/221 - (28%)
Similarity:101/221 - (45%) Gaps:24/221 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FISLALILCVLHSACGLYFHI---SETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGI 66
            |..||| |.|:|:   |.|.|   :..|..|..|.|.::..||||.|       :.|.|.....:
pombe    10 FFMLAL-LTVVHA---LNFDIPAKTNPEPFCLREYVGEKNLVIVNLK-------TTGNMGDGQTL 63

  Fly    67 GMHVEVRDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGA------QLRVHLDIQ 125
            .|.:.....:....:..|...:. ::|.........||..:..|   .||      :..|.|:..
pombe    64 SMMITDSSGNTHSSIQNVLGEKS-VAFDVDASAMLDICFLNTLT---PGAIESEHKKRSVKLEFT 124

  Fly   126 VGEHAIDYAHVAQKEKLTELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLA 190
            ||..|.||:.:.:...|..::..||:..|.:|:|..:..|.:.||.|||:|:||||.||..::..
pombe   125 VGADADDYSSLQKANNLEPVEADIRRARDFIEEIKGKIYYLQAREARFRNTNESTNERVKNFAYL 189

  Fly   191 QTVVLVCMGFWQMRHLKSFFEAKKLV 216
            ..:.|..:..||:.:|:|||:.|.|:
pombe   190 TFISLFVLVIWQILYLRSFFQRKHLI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 54/199 (27%)
erv25NP_593403.1 EMP24_GP25L 21..210 CDD:279450 54/202 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.