DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and tmed-12

DIOPT Version :9

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_508054.1 Gene:tmed-12 / 188279 WormBaseID:WBGene00011606 Length:167 Species:Caenorhabditis elegans


Alignment Length:137 Identity:86/137 - (62%)
Similarity:111/137 - (81%) Gaps:1/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LALILCVLHSACGLYFHISETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEV 72
            |..:|.:...|..|||||:|||:||||||:||||.|..||||:||||.:.|: ...|.|||||||
 Worm     4 LIALLSLATYADSLYFHIAETEKKCFIEEIPDETMVTGNYKVQLYDPNTKGY-GDYPNIGMHVEV 67

  Fly    73 RDSDDKIVLSRVYSSQGRISFTSHTPGEHVICMFSNSTAWFSGAQLRVHLDIQVGEHAIDYAHVA 137
            :|.:||::||::|:|:||.:|||:||||||||::||:||||:|||||||||||.|:||.|||.|.
 Worm    68 KDPEDKVILSKLYTSEGRFTFTSNTPGEHVICIYSNTTAWFNGAQLRVHLDIQAGDHAQDYAQVE 132

  Fly   138 QKEKLTE 144
            ::.||.|
 Worm   133 EERKLDE 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 83/125 (66%)
tmed-12NP_508054.1 EMP24_GP25L 16..>158 CDD:366467 83/125 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161750
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1690
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1294924at2759
OrthoFinder 1 1.000 - - FOG0001070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22811
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.