DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and TMED1

DIOPT Version :10

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_006849.1 Gene:TMED1 / 11018 HGNCID:17291 Length:227 Species:Homo sapiens


Alignment Length:208 Identity:46/208 - (22%)
Similarity:86/208 - (41%) Gaps:32/208 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FHISETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVE-VRDSDDKIVLSRVYS 86
            |.:....::||.:..|...::...|:|             ..|.|:.|: ..:|...::|    .
Human    36 FLLPAGRKQCFYQSAPANASLETEYQV-------------IGGAGLDVDFTLESPQGVLL----V 83

  Fly    87 SQGRISFTSHT-----PGEHVICMFSNSTAWFSGAQLRVHL---DIQVGEHAIDYAHVAQKEKLT 143
            |:.|.:...||     .|::.:| |.||.:..|...:...|   .:|..|....:|...:.|::.
Human    84 SESRKADGVHTVEPTEAGDYKLC-FDNSFSTISEKLVFFELIFDSLQDDEEVEGWAEAVEPEEML 147

  Fly   144 ELQLR-----IRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGFWQM 203
            ::::.     |..:..::|:..:.....|..|.|.|:..|....||.:||.....||:.:...|:
Human   148 DVKMEDIKESIETMRTRLERSIQMLTLLRAFEARDRNLQEGNLERVNFWSAVNVAVLLLVAVLQV 212

  Fly   204 RHLKSFFEAKKLV 216
            ..||.||:.|:.|
Human   213 CTLKRFFQDKRPV 225

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:426051 43/201 (21%)
TMED1NP_006849.1 EMP24_GP25L 33..220 CDD:426051 43/201 (21%)
COPI vesicle coat-binding. /evidence=ECO:0000255 218..227 4/8 (50%)