DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and si:ch211-255i20.3

DIOPT Version :9

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_003199913.2 Gene:si:ch211-255i20.3 / 100535182 ZFINID:ZDB-GENE-141216-113 Length:220 Species:Danio rerio


Alignment Length:201 Identity:85/201 - (42%)
Similarity:132/201 - (65%) Gaps:5/201 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ACGLYFHISETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEVRDSDDKIVLS 82
            |..:||.:.|.|.||.|||:|.:|.|...:::|.:|.....   ::|.:|:.|.|||...::||.
Zfish    23 ASAMYFDLGEQEEKCIIEEIPVDTLVTGVFRLEYWDENKKS---NTPQLGLTVTVRDPQHEVVLL 84

  Fly    83 RVYSSQGRISFTSHTPGEHVICMFSNSTAW--FSGAQLRVHLDIQVGEHAIDYAHVAQKEKLTEL 145
            :.:...|:.:|||...|:|.:||.||||.:  |:|.:|:||||:|:|||.||......|:.:..:
Zfish    85 KRFGRYGKFTFTSPASGQHFLCMQSNSTRFSVFAGDRLKVHLDVQMGEHTIDPNAAKTKDTIKAM 149

  Fly   146 QLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGFWQMRHLKSFF 210
            :..::.|:||:..|:::|::||.|||:||..||.||..||||::.||.:|:.:|||||::||.||
Zfish   150 EYNLQHLIDQMRYISRQQDFQREREEKFRQMSEETNGNVLWWAIIQTSILLSVGFWQMKNLKDFF 214

  Fly   211 EAKKLV 216
            ..||||
Zfish   215 IEKKLV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 79/192 (41%)
si:ch211-255i20.3XP_003199913.2 EMP24_GP25L 25..214 CDD:279450 78/191 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1690
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 1 1.010 - - D1294924at2759
OrthoFinder 1 1.000 - - FOG0001070
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.