DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eca and gp25l

DIOPT Version :9

Sequence 1:NP_788616.1 Gene:eca / 41177 FlyBaseID:FBgn0069242 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_002937324.3 Gene:gp25l / 100489853 XenbaseID:XB-GENE-955109 Length:218 Species:Xenopus tropicalis


Alignment Length:204 Identity:91/204 - (44%)
Similarity:136/204 - (66%) Gaps:4/204 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LHSACGLYFHISETERKCFIEEVPDETTVIVNYKVELYDPRSNGFMPSSPGIGMHVEVRDSDDKI 79
            |.||  :|||::|.|.||.||::|.||.|...||::.:|.:.:.|:||:||:||.|.|...:.::
 Frog    17 LSSA--MYFHVAEKEEKCLIEDLPSETLVTGRYKIQKWDLKEHDFLPSAPGLGMVVTVTAPNGEV 79

  Fly    80 VLSRVYSSQGRISFTSHTPGEHVICMFSNST--AWFSGAQLRVHLDIQVGEHAIDYAHVAQKEKL 142
            :||::|...|:.:||||:||||.||:.||||  ..|...:||:|.|||.||:.:|:..:..|:|:
 Frog    80 LLSKLYGPDGKFTFTSHSPGEHTICLQSNSTNLIAFVSNKLRIHFDIQSGENPLDFHIINAKDKV 144

  Fly   143 TELQLRIRQLLDQVEQITKEQNYQRYREERFRHTSESTNSRVLWWSLAQTVVLVCMGFWQMRHLK 207
            .|:...:..|..::..|.|:|.|||.|||.:|..||.||:.||||::.||.:|..:|.||::|.|
 Frog   145 KEVTYGLEHLRGEINHIIKQQEYQREREEHYRGKSEETNNNVLWWAIIQTAILTSVGIWQIKHFK 209

  Fly   208 SFFEAKKLV 216
            .|..|||:|
 Frog   210 DFLIAKKVV 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ecaNP_788616.1 EMP24_GP25L 20..211 CDD:279450 84/192 (44%)
gp25lXP_002937324.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53581
OrthoDB 1 1.010 - - D1294924at2759
OrthoFinder 1 1.000 - - FOG0001070
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X178
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.