powered by:
Protein Alignment CG18542 and yjgM
DIOPT Version :10
| Sequence 1: | NP_649928.1 |
Gene: | CG18542 / 41176 |
FlyBaseID: | FBgn0037731 |
Length: | 249 |
Species: | Drosophila melanogaster |
| Sequence 2: | YP_026287.1 |
Gene: | yjgM / 948772 |
ECOCYCID: | G7886 |
Length: | 167 |
Species: | Escherichia coli |
| Alignment Length: | 37 |
Identity: | 8/37 - (21%) |
| Similarity: | 13/37 - (35%) |
Gaps: | 14/37 - (37%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 139 RIVAAISVKNHHAVYNAAWIYRFAIDPHYPCQTIMDP 175
|::..:|.: |....|..| |:.||
E. coli 24 RVIRQVSAE-----------YGLTADKGY---TVADP 46
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG18542 | NP_649928.1 |
None |
| yjgM | YP_026287.1 |
MnaT |
8..148 |
CDD:440860 |
8/37 (22%) |
| ArgA |
<80..167 |
CDD:440859 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Return to query results.
Submit another query.
