DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18542 and Nat8f4

DIOPT Version :10

Sequence 1:NP_649928.1 Gene:CG18542 / 41176 FlyBaseID:FBgn0037731 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_083607.3 Gene:Nat8f4 / 75541 MGIID:1922791 Length:226 Species:Mus musculus


Alignment Length:99 Identity:21/99 - (21%)
Similarity:35/99 - (35%) Gaps:0/99 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 IVAAISVKNHHAVYNAAWIYRFAIDPHYPCQTIMDPMIKLVVKNCIIGGYASLECTISEWQESER 204
            ||.|..||:.........::|.::...:..|.|...:::.|:.......|:.:....|..|.|..
Mouse   120 IVGARPVKDPPLGKKQMQLFRLSVSSQHRGQGIAKALVRTVLWFARDQDYSDVVLETSCVQYSAV 184

  Fly   205 DFYDDFGFVTRQIYHKKIIGSSLAVMKTQLTYGL 238
            ..|...||.....|...|....:.:.....||.|
Mouse   185 ALYQAMGFRKTDQYFVSIATRLMGLSILHFTYSL 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18542NP_649928.1 None
Nat8f4NP_083607.3 yhbS <104..211 CDD:442387 18/90 (20%)

Return to query results.
Submit another query.