DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18542 and nat14

DIOPT Version :10

Sequence 1:NP_649928.1 Gene:CG18542 / 41176 FlyBaseID:FBgn0037731 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001038809.2 Gene:nat14 / 751624 ZFINID:ZDB-GENE-060825-15 Length:280 Species:Danio rerio


Alignment Length:77 Identity:15/77 - (19%)
Similarity:32/77 - (41%) Gaps:11/77 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVIRNYTQDDELKCQELVRDYIMSFSNKSFFVYCFREITLQFIVITWAI-------FFIFLGVP- 61
            :|:|...:.|....:.|:::......|:.......|.:.|..:.|..:|       |.:.|.:| 
Zfish     9 VVLRRMQEKDIEAVKALIKEGCEGTENRLILHLLTRPLALLLLAILSSILRCVLHSFVLALVIPV 73

  Fly    62 ---LLFCALTVP 70
               :::..||:|
Zfish    74 FISVIYLKLTIP 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18542NP_649928.1 None
nat14NP_001038809.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..152
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.