DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18542 and Nat14

DIOPT Version :10

Sequence 1:NP_649928.1 Gene:CG18542 / 41176 FlyBaseID:FBgn0037731 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_958743.1 Gene:Nat14 / 269854 MGIID:3039561 Length:206 Species:Mus musculus


Alignment Length:67 Identity:11/67 - (16%)
Similarity:28/67 - (41%) Gaps:13/67 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IRNYTQDDELKCQELVRDYIMSFSNK----------SFFVYCFREITLQFIVITWAIFF---IFL 58
            :|...:|::....|:::..:....|:          :..:.......|:||:.::|:..   :||
Mouse     8 VREMREDEKPLVLEMLKAGVKDTENRVALHALTRPPALLLLAAASSGLRFILASFALALLLPVFL 72

  Fly    59 GV 60
            .|
Mouse    73 AV 74

Return to query results.
Submit another query.