DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18542 and SPOM_SPBC1271.07C

DIOPT Version :10

Sequence 1:NP_649928.1 Gene:CG18542 / 41176 FlyBaseID:FBgn0037731 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_595143.1 Gene:SPOM_SPBC1271.07C / 2539810 PomBaseID:SPBC1271.07C Length:163 Species:Schizosaccharomyces pombe


Alignment Length:62 Identity:15/62 - (24%)
Similarity:30/62 - (48%) Gaps:5/62 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 MIKLVVKNCIIGGYASLEC-TISEWQESERDFYDDFGF-VTRQIYHKKIIGSSLAVMKTQLT 235
            ::|.:::.....||:|:.. |:.....:.| .|..||| .|...||..|  .::..|:.:::
pombe   104 LVKEIIQYSEKLGYSSMVLDTLDTLLPAVR-LYKSFGFKTTEPYYHNPI--PNVVYMRLEMS 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18542NP_649928.1 None
SPOM_SPBC1271.07CNP_595143.1 PhnO 35..162 CDD:440222 15/60 (25%)

Return to query results.
Submit another query.