DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18542 and nat8.2

DIOPT Version :10

Sequence 1:NP_649928.1 Gene:CG18542 / 41176 FlyBaseID:FBgn0037731 Length:249 Species:Drosophila melanogaster
Sequence 2:XP_004911372.2 Gene:nat8.2 / 100489204 XenbaseID:XB-GENE-22166516 Length:223 Species:Xenopus tropicalis


Alignment Length:90 Identity:22/90 - (24%)
Similarity:35/90 - (38%) Gaps:17/90 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IVIRNYTQDDELKCQELVRDYIMSFSNKSF---------FVYCFREITLQFIVITWAIFFIFLGV 60
            :.||.|...|....:|:....|...:||:|         :::.|......|||| .::|...|  
 Frog     4 VSIRLYKDSDYGVTREMFARGITEHTNKAFRHTLGIPHIWLFLFLTFLAPFIVI-GSLFVSSL-- 65

  Fly    61 PLLFCALTVPACIFCLFTGTYFSFY 85
                 |:|:...|..|.....|:.|
 Frog    66 -----AITLALLILWLLNRYMFTTY 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18542NP_649928.1 None
nat8.2XP_004911372.2 PhnO 96..194 CDD:440222
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.