DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and Nme2

DIOPT Version :9

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_114021.2 Gene:Nme2 / 83782 RGDID:619877 Length:152 Species:Rattus norvegicus


Alignment Length:152 Identity:40/152 - (26%)
Similarity:67/152 - (44%) Gaps:29/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 TLAIIKPHSIKDGLLGDIISEILSNGFRLTAMRMILMARINCEEFY------EVYRGVVPEYI-- 304
            |...|||..::.||:|:||......||||.||:.:..:..:.::.|      ..:.|:| :|:  
  Rat     7 TFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLV-KYMNS 70

  Fly   305 -PMVAQLASGVCMCMEIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNAVHC 368
             |:||.:..|:.:.          ||.|.......|.|.      :|.|:|..|.....:|.:|.
  Rat    71 GPVVAMVWEGLNVV----------KTGRVMLGETNPADS------KPGTIRGDFCIQVGRNIIHG 119

  Fly   369 TDLPDDSNLELQYMFK---IID 387
            :|..:.:..|:...||   :||
  Rat   120 SDSVESAEKEIGLWFKPEELID 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDK 246..387 CDD:197791 38/150 (25%)
NDPk7B 246..383 CDD:239875 36/143 (25%)
Nme2NP_114021.2 Interaction with AKAP13. /evidence=ECO:0000250|UniProtKB:P22392 1..66 18/59 (31%)
PTZ00093 3..151 CDD:173387 40/152 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.